KEGG   Neurospora crassa: NCU04230Help
Entry
NCU04230          CDS       T01034                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU04230
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCU04230
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCU04230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 548 aa AA seqDB search
MAANNMVNPAVDPALEDELFAKEVEEVKKWWSDSRWRQTKRPFTAEQIVSKRGNLKIEYA
SNAQAKKLWKILEDRFAKRDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASSSDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKDQREKLANIDYLRPIVADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRAQA
DIMGSDLLCIARTDAEAATLITTTIDPRDHAFILGCTNPDLEPLADLMMKAEAEGKTGAQ
LQAIEDDWLAKADLKRFDEAVLDVIAKGKFSNAKDLAAKYQAAVKGKQISNREARAIARQ
LLGQEIFFDWESPRTREGYYRLKGGCDCSINRAISYAPYCDAIWMESKLPDYAQAEEFAK
GVHAVWPEQKLAYNLSPSFNWKTAMGRDDQETYIRRLAKLGYCWQFITLAGLHTTALISD
QFAKAYSKIGMRAYGELVQEPEIDNGVDVVKHQKWSGATYVDELQKMVTGGVSSTAAMGK
GVTEDQFH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaacatggtcaaccccgccgtggatcccgctctcgaggacgagcttttc
gccaaggaggtcgaggaggtcaagaagtggtggagcgactcacgctggaggcaaaccaag
cgccctttcaccgctgagcagatcgtctccaagcgtggaaacctcaagatcgagtacgcc
agcaatgcgcaggccaagaagctttggaagatcctcgaggaccgcttcgctaagcgcgat
gcctcttacacatacggctgcttggagcctaccatggtgacccagatggccaagtacctc
gataccgtctacgtttccggctggcaatcatcctcgaccgcctcctcttctgacgagccc
ggcccggatcttgctgattacccctacaccaccgtccccaacaaggttggccacctcttc
atggcccagctcttccacgaccgcaagcagcgccaggagcgcctctccgtccccaaggac
cagcgcgagaagctcgccaacatcgactacctccgccccatcgttgccgatgctgacacc
ggtcacggtggtctgaccgccgtcatgaagctcaccaagctcttcattgagaagggtgct
gccggtattcacattgaggaccaggcccctggtaccaagaagtgcggccacatggccggc
aaggtcctcgttcccatccaggagcacatcaaccgtctcgtcgccatccgtgcccaggct
gatatcatgggctccgacctcctctgcattgcccgtaccgatgccgaggccgccaccctc
atcaccaccaccatcgacccccgcgaccacgcttttatcctcggctgcaccaaccccgac
ctcgagcccctcgccgacctcatgatgaaggctgaagccgagggcaagaccggtgcccag
ctccaggccattgaggacgactggctcgccaaggccgaccttaagcgctttgacgaggcc
gtccttgatgtcatcgccaagggcaagttttcaaacgccaaggacctcgctgccaagtac
caagccgccgtcaagggcaagcagatctccaaccgcgaggcgcgcgccattgcccgccag
ctgctcggccaggagatcttctttgactgggagtccccccgtacgcgcgagggctactac
cgcctcaagggcggctgcgactgctccatcaaccgcgccatctcctacgctccctactgc
gacgccatctggatggagtccaagcttcccgactacgctcaggccgaggagttcgccaag
ggcgtccacgccgtctggcccgagcagaagctcgcctacaacctttctccctccttcaac
tggaagaccgccatgggccgcgacgaccaagagacgtacatccgccgcctcgccaagctc
ggctactgctggcagttcatcaccctcgcgggcctgcacaccacggcgctcatcagcgac
cagttcgccaaggcgtacagcaagatcggcatgcgcgcctacggcgagctcgtccaggag
cccgaaattgacaacggcgtcgatgtcgtcaagcaccagaagtggtcgggcgccacgtac
gtggatgagctgcagaagatggtcaccggtggtgtcagctcgacggcggcgatgggcaag
ggtgtcactgaggatcagttccactag

DBGET integrated database retrieval system