KEGG   Neurospora crassa: NCU04288Help
Entry
NCU04288          CDS       T01034                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU04288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 357 aa AA seqDB search
MAGLFGSAAASASNTLGDLKQDVELGQPPEDSISDLAFNPNPADQKDFLAVASWDKKTRI
YEILSNGQGQGQAMIEHDAPVFSCDFFKDGTKVISAGADKAAKVLDLATGQSMQVAAHDM
PIKCVRYFEANGTPMAVTGGWDKQIKYWDFRSANPAATVQAQERVYTMDVRDNLLVVGTA
DRYINVINLKDPGKFYKTMQSPLKWQTRVVSCFNDSQGFAIGSIEGRCAIQYVEDKDSAS
NFSFKCHRDPAQGNTTAVHAVNDISFHPQHGTFSTAGSDGTFHFWDKDAKHRLKGYPNVG
GSITSTTFNKTGSIFAYAISYDWSKGYQGNSPTYPTKVMLHPVQQDECKPRPSVKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctttttggttccgccgccgcatccgcgagcaacaccctcggcgatcttaag
caggatgtcgagctcggccaaccccccgaggacagcatcagcgaccttgccttcaacccc
aaccccgccgaccagaaggacttcctcgccgtagccagctgggacaagaagacacgcatt
tacgagatcttgagtaatggtcaaggtcagggacaggccatgattgagcatgatgccccc
gttttctcttgcgatttcttcaaggacggcacaaaggtcatttccgccggcgccgacaag
gccgccaaggttctcgatttggccaccggtcagtcgatgcaggtcgctgctcacgatatg
cccatcaagtgcgttcgctacttcgaggccaatggcacgcccatggcggtgacaggtggc
tgggacaagcagatcaagtactgggatttccgctccgcgaacccggccgccacggtgcag
gcccaggagcgcgtttataccatggatgtgcgcgacaacttgctcgtggtcggaaccgct
gatcgctatatcaacgtgatcaacctgaaggaccccggcaagttctacaagacaatgcag
agccctcttaaatggcagactcgtgtggtcagctgcttcaacgattctcagggctttgct
atcggctcgatcgagggtagatgcgccattcaatatgtggaggacaaggattctgcctcc
aacttctctttcaaatgccaccgcgaccccgcccaaggcaacaccacggccgtccacgct
gtcaacgacatctccttccacccccaacacggcaccttcagcacagccggtagcgacggc
accttccacttctgggacaaggacgccaagcaccgtctcaagggttaccccaacgtcggc
ggcagcatcacctcgacaacgttcaacaagaccggcagcatctttgcctacgccattagt
tatgactggagcaaggggtaccaaggcaactcgcccacgtacccgaccaaggtcatgctc
cacccagtacagcaggacgagtgcaagccccgtccgagcgttaagaagaggtag

DBGET integrated database retrieval system