KEGG   Neurospora crassa: NCU04303Help
Entry
NCU04303          CDS       T01034                                 

Definition
asparagine synthetase 2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ncr  Neurospora crassa
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCU04303
Enzymes [BR:ncr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NCU04303
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C44
   NCU04303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 581 aa AA seqDB search
MCGIFACHNHPDVAKFKPTALKLSKAIRHRGPDWSGSVTCHNTILCHERLSIVGVESGAQ
PLTNADESIAVAANGEIYNHRLIRKHLKNPYHFKTTSDCEVIIPLYLEHGVDAPKHLDGM
FSFVLYDKKQDRTIAARDPIGITTLYKGYNSQEPGTVYFASELKSLHPVCDKIEAFPPGH
VFDSLTGETTRYFEPSWWDEKKCPQTPLDLKLLRETLEKSVRKRLMAEVPYGVLLSGGLD
SSLVAAIAQRESLRLRKLAEEQAALNQEVDPEAQDKGEGLVGIDDENKLSTVTFLPQLNS
FSIGLPGSPDNKAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLETYDVTTIRASTPM
YLLSRKIKAMGIKMVLSGEGSDEIFGGYLYFHGAPNKEEFHEECVRRVKNLHLADCLRAN
KSTSAWGLEARVPFLDKEFLEVALNIDPQEKMITKEKLEKYILRKAFDTKDQPEGAYLPD
NILYRQKEQFSDGVGYGWIDALKDQAELQVTDEMMKNPKPEWGDDIPDTKEAYWYRCMFD
EHFPPSCASTVMRWTPKWVKQTDPSGRAISIHQAKYDHVDE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctttgcttgccacaaccacccagatgtcgccaagttcaagcctacggct
ctgaagctttccaaggccatccgtcaccgtggtcctgattggagcggcagcgtcacttgc
cacaacactattttgtgccatgagcgtctcagtatcgtcggtgttgagagtggcgctcag
cctctcaccaacgccgatgagagcattgccgttgccgccaacggcgaaatctacaaccat
cgtcttatccgcaagcacttgaagaacccctaccacttcaagaccacctcagattgcgag
gtcatcattcctttgtaccttgagcacggcgtcgatgcccccaagcacctcgatggcatg
ttctctttcgttctctacgacaagaagcaggaccgcacgatcgccgcccgcgaccccatc
ggtatcaccactctctacaagggctacaactcccaggagcccggcaccgtctacttcgcc
tccgagctcaagtccctccaccctgtttgcgacaagatcgaggctttccctcccggccac
gttttcgacagcttgactggcgagaccacccgttacttcgagccttcgtggtgggatgag
aagaagtgcccccaaactcctctcgacctcaagcttctccgcgagacccttgagaagtct
gtcaggaaacgtctgatggctgaggtcccctacggtgtccttctttccggtggtcttgat
tcctctttggttgctgctatcgctcagagagagtctctccgtctgaggaagctcgctgag
gagcaggctgccctcaaccaggaggttgaccccgaggcccaggacaagggcgagggtttg
gttggtattgatgatgagaacaagctctcgaccgtcactttccttccccagctcaactcc
ttctccatcggtctccccggctcccccgacaacaaggccgccctcgaggtcgccaagttc
ctcggcaccaagcaccacgtcatgaccttcactattgaggatggtcttaacgcgctttcc
gatgtcatctaccacctcgagacctacgatgtcaccaccatccgtgcctctacccccatg
tacctcctctctcgcaagatcaaggccatgggtatcaagatggttctctctggtgagggc
tctgacgagatcttcggtggttacctctacttccacggcgctcccaacaaggaggagttc
cacgaggagtgtgtccgtcgtgttaagaacctccacttggccgactgcctgcgcgccaac
aagtccacctctgcttggggtcttgaggcccgtgtgcccttcctcgacaaggagttcctc
gaggttgctctcaacatcgatccccaggagaagatgatcaccaaggagaagctcgagaag
tacatcctccgcaaggccttcgacaccaaggaccagcccgagggtgcttacctccctgac
aacatcctctaccgccagaaggagcagttctccgacggtgtcggctacggatggatcgac
gctctcaaggaccaggccgagctccaagtcactgacgagatgatgaagaaccccaagccc
gagtggggtgacgacatccccgataccaaggaggcttactggtaccgctgcatgttcgac
gagcacttccccccttcgtgcgcgtctaccgtcatgaggtggactcccaagtgggtcaag
cagaccgaccccagtggcagagccatctccattcaccaagccaagtatgaccacgtggac
gagtaa

DBGET integrated database retrieval system