KEGG   Neurospora crassa: NCU04333Help
Entry
NCU04333          CDS       T01034                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Pathway
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    NCU04333
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU04333
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU04333
Ubiquitin system [BR:ncr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    NCU04333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group V; V
AA seq 992 aa AA seqDB search
MMNSTGHLPAGQPMQGNADMGIPRMNGGPGGQGHLGQGHGPRRGRPHHNHYNPGAHHHHH
HGQYHQPHVAHQPMYAANYMPQPYGVPPGYYAPPAYQNAATMNPYGMPQYAPPAATYARS
PPAMQHYMPMVAQNPYARPAPPQSPIVSTPYQAPPMPPPALVPVPAPHTPSSTHSHVVPT
PMTPPAQQMPPIVPPKAQIQSQPQVQVQPEPEPEIQQQVVVEEPVAEEAKQPAQAEAVYS
HFASPQKSDKPPFSLPWFSHPDTPFPARTKLRRRRQAPSAASESVSLPTAPGQHYEAAPV
ESAPTENVQEDAAVSTPKGTPKLEILPPRSETPSTQELPSVDTPSTSPTGSIPSQQLQVS
ESVTASPAQPAKQATRVPVPAVPAVPVVPVLPKPAPKDKPATSEEKPSTETKSAGSTPAA
EETSEATAKDSTSSTPESSAPAAQTAPAPAPVKPKSWANLFTKPAAPVNAAAVATAAASA
SQTTVNDNAVADASGAAAGVATGFAQSKATSMAEAVQSYRVGTAEKIAFLEPRGLVNTGN
MCYMNSILQVLVNCIPFYDFLDQVSKKAVHSFNSETPLLDAMIMFMREFKVIDSAVSIDQ
LKRRLKSEELEQYGEAFTPEFVYDAIRKLPRFASMRRGHQQDAEEFLGFLLEGLHDECTH
VMSTLPVSTTSTAPNSSLPSPTASNTGDDWLEVGPRQKAAITRTSGYSSSISPITRIFGG
QLRSELRIPGLKSSVTLEPYQPLQLDIGAPEVRNIVDALRGLTRPETIHGDFNSPHGKDA
KATKQVFIESLPPVLILHLKRFQFDAEGHGTIKIWKKVGYPLELEIPREVVSRQKRNTTH
AENADLLKYRLITVVYHHGKNASGGHYTVDVRRQDGREWVRIDDTVIRRVRPEDVAEAGA
EEKPSKGAVGDRRENGSSAAASNRFGAMNDDDTGDDEGWKQATASGKKWSSVVNGAGLAA
PSGSGSLKAAAKQHNDSFKDNKVAYLLFYQRI
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagcaccgggcatctgccggctgggcagccaatgcagggtaatgccgatatg
ggaatccccaggatgaatggaggccccggtggccagggccatctcggtcagggccacggt
ccccgtcgcggacggcctcaccacaaccactacaatcctggcgcccaccaccaccaccac
catgggcagtatcaccagcctcatgtcgcgcaccaacccatgtatgccgccaactacatg
ccacagccttacggtgttccccctggctactatgccccccctgcctaccagaacgccgcc
accatgaacccctacggcatgccgcaatacgctccgccagccgccacctacgctcgatcg
cccccggccatgcagcactacatgcccatggtagctcagaatccctacgctcgcccggct
cctccccagtctcccatcgtctcgaccccgtaccaggctccccccatgcctccgccagcg
ctcgtaccggttcctgctccccacactccctcgtcgacacactctcacgtcgtcccgacc
cctatgaccccgccggctcagcagatgccaccgatcgtccctcccaaggcacagattcag
tcgcagcctcaagttcaggttcagcctgagcccgagcccgagattcagcaacaggtggtg
gtggaggagccggtggctgaggaggctaaacagcccgcgcaggctgaggccgtatactcg
cacttcgcttcgccgcaaaagtctgacaaaccgccgttctctctcccttggttttcgcat
cctgataccccgttcccggctcgtacaaagcttaggagacgccggcaagctccttctgct
gcctcggaaagtgtcagccttcctactgctcctggccaacactacgaagctgctccagta
gaaagtgctcccacggaaaatgtccaggaagatgcggctgtctctacgcccaagggcacg
cctaagcttgagattcttcctccccggtctgaaactccttcgactcaagagcttccttct
gtggacaccccgtcgacttcgccgactggctccatcccatcccagcagctccaagtttcc
gagtccgtcacggcctctccggctcagcccgcgaagcaagctactcgtgtccccgttccc
gctgtccctgccgtccctgtggttcctgttttgccgaagcctgctccgaaggacaagccc
gcgactagcgaggagaagccgtctactgagaccaagtctgctggttctacccctgctgct
gaggaaacttctgaggctactgccaaggattcaacgtcttcgacgcccgagtcctcggct
ccggctgcacaaactgctcccgcgcccgcacctgttaagcctaagtcttgggccaacttg
ttcaccaagcctgccgctcctgttaacgccgctgccgttgcgaccgctgccgcctctgct
tcccagaccactgtcaacgacaacgccgtcgcagatgcttcaggagccgctgctggggtt
gccactggctttgctcagtctaaggcgacctccatggccgaggctgttcagtcctaccgg
gtggggaccgctgagaagattgctttcttggagccccgcggccttgttaacactggtaac
atgtgctatatgaactctattcttcaagttttggttaactgcattcctttctatgacttc
ttggatcaagtcagcaagaaggctgtccacagcttcaacagcgagactcctctcctcgat
gccatgatcatgttcatgcgcgagttcaaggtaatcgattctgctgtatctattgaccag
ctcaagaggcgcctcaagagcgaggaactcgagcagtacggtgaagccttcactcccgag
tttgtctatgacgctatcagaaagctccctcggttcgcaagcatgcgccgtggtcatcaa
caagatgccgaggagttcctcggtttcctccttgaaggtctccacgatgagtgcactcac
gtcatgagtactctcccggtttcgactacttcaactgcgcccaactcgtccttgccctcg
cctacggcgtccaacactggtgatgactggctcgaggttggaccccgtcaaaaggctgca
attactcgtacttctggttattcctcttcgatctctcccattactaggatcttcggtggt
caactccgctctgaactccgcattcctggcctcaaaagctccgttaccctggagccctat
cagccccttcagctcgatattggtgctcccgaggttcgtaacattgttgatgctttgaga
ggtcttactcgtccagagacaattcacggagatttcaattcgccccatggcaaggacgca
aaggctaccaagcaggtgttcatcgagtctctgcctccagtcctcattttgcatcttaaa
cgcttccagttcgatgctgaaggccatggtaccatcaagatttggaagaaggtcggatat
cccttggagctcgaaatccctcgcgaggtcgtctctcggcagaagcgcaacactactcat
gctgagaatgccgatcttctcaagtatcgtctcatcacggttgtctatcatcacggaaag
aacgccagcggcggacattatacagttgatgttcgtcgccaggacggccgtgaatgggtt
cgcattgacgatactgtaattcgccgtgtgcgccctgaggacgtcgctgaggctggcgca
gaggagaagccctccaagggcgccgttggtgaccgcagggagaacggcagctcggcagca
gctagcaaccggttcggcgctatgaacgatgatgatactggtgatgacgagggctggaag
caggctactgcgagcggcaagaagtggagcagtgtcgtcaacggtgccggtcttgctgct
cctagcggcagtggcagcttgaaggctgccgccaagcaacataatgatagcttcaaggac
aacaaggtcgcttacctgttgttctaccagcgtatctga

DBGET integrated database retrieval system