KEGG   Neurospora crassa: NCU04339Help
Entry
NCU04339          CDS       T01034                                 

Definition
(RefSeq) ribokinase
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
ncr  Neurospora crassa
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCU04339
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NCU04339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group IV; IV
AA seq 349 aa AA seqDB search
MTTSTSTPRITVLGSLNIDLVAYVSHHPLPGETMTANSVAVSPGGKGANQAVACAKLSRS
HTSSSSSSSSFAEETAHITMLGTVGADSYGSLLKENLAKHGVDVSGVRVLDSPPGAKTGM
AMIVVDEPTGQNRIILSPEANHFLQPEHVSEVAHLSSSSVGGAAQEKPDLLIMQLEIPVP
TVLQALRTAKQNGVQVLLNPAPAVPLPDEAFDGLAHLVVNETEAAILSGLEESVLDTEEG
LEKVGKVFLEKGVKTVIVTLGGRGVFFMTGGGEGGSKKGLIKAEKAKVVDTTAAGDTFVG
MYALEVVIAAKKGEQFDIEGAVRKANKAAAKTVERPGAQDSIPWRDELL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctacctccacccccagaattacagtcctaggctccctaaacatagacctg
gtagcctacgtctcccaccacccgcttccaggagaaaccatgaccgccaactccgtcgcc
gtctcccccggcggaaagggagccaaccaagccgtcgcatgcgccaagttatcccgctcc
cacacttcctcttcttcttcttcctcttctttcgctgaagaaaccgctcacatcaccatg
ctcggcacagtcggcgccgactcttatgggtccctgctcaaagaaaaccttgccaaacac
ggcgtcgacgtctcgggcgtgcgcgttctggattctcctcccggagccaagacgggcatg
gccatgattgtggtggacgagccgacgggccagaaccgcatcatcttgagtcccgaggcg
aaccatttcctccagcccgagcacgtttccgaggttgcacacctcagtagcagcagtgtt
ggtggtgcggcccaagaaaagccggatttgctcatcatgcagctcgagatccccgtgccg
acggtgctgcaggcgctcaggacggccaagcagaatggggtgcaggtcctgctgaacccg
gcgccggcggtccccttgccggatgaggcgtttgacgggctggcgcacttggtggtgaat
gagacggaggcggccattcttagcgggttggaggagtcggtgctggacacggaggaaggg
ctggagaaagtgggcaaggtgtttttggaaaagggggtgaaaacggtgattgtcactttg
ggtgggcggggagttttcttcatgactggtggtggtgaggggggaagcaaaaagggattg
atcaaggcggagaaggccaaggtggtggataccacggcggcgggtgatacgtttgtcgga
atgtatgcgctggaggtggtgattgctgccaaaaagggggaacagttcgatatcgagggc
gcggtaaggaaggcgaataaggcggcggcgaagacggtggagaggcccggggcacaggat
tcgattccttggagggatgagttgttgtag

DBGET integrated database retrieval system