KEGG   Neurospora crassa: NCU04395Help
Entry
NCU04395          CDS       T01034                                 

Definition
endo-1,6-beta-D-glucanase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ncr  Neurospora crassa
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NCU04395
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NCU04395
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NCU04395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 480 aa AA seqDB search
MYPPALTLLLTPGLVAAAIQPQAYASSADGRYKLSSYSAPVRGTGTPGSNSTWKLTIDDT
PSGRKQTIKGFGAAVTDSTVSVFNALPSAQRTALLNTLMTTAGANFAMMRHTIASSDLSA
NPAYSYDDSNGQTDLSLSNFNLGGRGNAMASLLAEMRRLQPGLTILGSPWSPPGWMKLNR
AIQGTTVNNNLDHAYASQFAQYFVKYLQAYQAKGATIDAITIQNEPLNSRAQMPTMYIYA
DEAGDLIQNNIGPALRNAGLDTKIWAYDHNTDQPSYPSTVLSRAGGYVPAVAWHCYASSL
DWSVLTTFHNAHPGVEQYMTECWTSAKQPTPWNWAASFTMGPLQNWASGVTAWVLGTDTN
DGPHLTGSDACDKCTGLVTVDAAAGTYNLRGDYYMMAQFSKFMKKGAVVMSGTGSWTYGD
GSGLESVAATNADDGSRVVVIENKFGNEIYVTVEAKSGEVWSGLVYRNSVVTWVLPAAGA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccccagccctcaccctcctcttaactccaggactagtcgctgcagcgatccaa
ccccaagcctatgcctcctcagcagatggcagatacaaactctcctcctacagcgctcca
gtccggggcaccggcactccgggatccaactcaacatggaagctcaccatagacgacact
ccctctggtcggaagcaaaccatcaaaggcttcggcgccgccgtcaccgactccaccgtg
tccgtcttcaacgccctcccctccgcccaacgcaccgccctgctcaacaccctcatgacc
accgccggcgccaatttcgccatgatgcgacacaccattgcctcctccgacctctctgcc
aacccagcctattcgtacgatgactccaacggccaaaccgatctatccctttccaacttc
aacctcggcggccgcggcaacgccatggcctcgctactcgccgagatgagacgtctccaa
cccggcctcaccatcctcggctctccctggagtccaccaggttggatgaagctcaaccgc
gcgattcaaggcaccacggtaaacaacaacctcgaccacgcctacgcctcccagttcgcc
cagtacttcgtcaaatacctccaagcataccaagccaagggcgccacaatcgacgccatc
accatccaaaacgaaccgctcaactcgcgcgcgcagatgccgaccatgtacatctacgcg
gacgaggccggtgatctcattcagaacaacatcggtccagctctgcgcaacgccgggctg
gataccaaaatctgggcatacgaccacaacaccgaccaaccctcctacccgtccactgtc
ctttctcgggcgggcgggtacgttcccgcggtggcatggcattgctacgccagctcgctg
gactggtctgtcttgaccacctttcacaacgcccacccgggcgtggagcagtacatgact
gagtgctggacgtcagcaaagcagccgacgccgtggaactgggctgcaagcttcaccatg
ggaccgctgcagaactgggcgagcggggtgacggcgtgggtcctggggacggataccaat
gatgggccgcacttgacgggcagtgatgcgtgtgataagtgcacggggctggtgacggta
gatgcggcggcggggacgtataatttaaggggagattattacatgatggcgcagttttcg
aagtttatgaagaagggcgccgtggtgatgagtggaacgggaagttggacgtatggggat
gggagcggactggagagcgtggcggcgacgaatgcggatgatgggagtagggtggtggtg
attgagaataagtttgggaacgagatttatgtgacggttgaggcgaagagtggggaggtt
tggagcgggttagtttatagaaactcggtggtgacttgggttttgccggctgcaggggcg
taa

DBGET integrated database retrieval system