KEGG   Neurospora crassa: NCU04612Help
Entry
NCU04612          CDS       T01034                                 

Definition
similar to mitogen activated protein kinase kinase 2
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ncr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 511 aa AA seqDB search
MADPFAPRSMKRKNVKGLALAPAAPKPPPTAETFYKDKDDDNNAQLEIGIEFNLDLRPED
LDLIKELGAGNGGTVSKVRHIPTNTVMARKVIHVEAKKEMRKRIVRELQIMHGCHSEYIV
TFYGAFLNEHNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAEATLGGLTYLYSKHHI
MHRDIKPSNILVNSKGHIKLCDFGVSGELVNSVADTFVGTSTYMAPERIQGDKYTVKSDV
WSFGLTVMELAIGKFPFASDQLGDDAENAPAGILDLLQQIVHEPAPKLPKSDAFPQILED
MIQKCLYKEPERRPTPQELFDRDPFVQAAKRTPVDLREWACSLMDRDNRKSHLQPQLSPS
SHDFLRSSDEPTPTSGEIPILGTMVSPRDQHGSVPTRPPPSSRTGSAGRTGGPSVHPGLG
SRAATTGSQPRYPQQAPPPPHPPFEKRPSMSTGHSYTSSSSSSRSGFALPIRPGPPGQPM
PPPPPRRQLTAEELQRESRRQAAMQPPTGRF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccatttgccccgcgctccatgaagcgcaagaacgtcaaaggtcttgccttg
gctcctgccgctcccaagcccccgccgacggccgagaccttttacaaggataaagacgac
gacaacaatgcccagctagagatcggcatcgagttcaacctggacctcaggcccgaagat
ctggacctcatcaaagagttgggagctggaaacggaggcacagtcagcaaagtcaggcat
atcccgacaaatacagttatggctcgcaaggttatccatgttgaggccaagaaggagatg
cgcaagcgtatcgttcgcgagcttcagatcatgcacggctgccattccgaatacattgtc
accttctatggcgccttccttaacgagcacaacgatgtgatcatgtgcatggagtacatg
gatgttggctcgctcgaccgtatctcccgtgtcttcggtccagtccgcgttgatgtcctc
ggaaagattgctgaagctacccttggcggtctcacgtacctctactccaaacaccacatc
atgcacagagacatcaagccctccaacatcctcgtcaactcaaagggccacatcaagctt
tgcgatttcggtgtttccggagagctagttaactctgtcgccgacacctttgtgggtaca
tccacatacatggctcccgaaagaatccagggcgacaagtacacagtcaagtctgatgtg
tggagtttcggcttgactgtcatggagttggcgattggcaagttcccgttcgccagtgat
caacttggggatgatgctgaaaatgctcccgccggtattctcgaccttctccaacaaatt
gttcacgagccagcaccgaagctacccaagagcgatgctttcccacaaatccttgaggat
atgatccagaagtgtctttacaaggaacccgagaggcggccgacgcctcaagagctcttt
gaccgcgatccctttgtacaagcggcgaagagaaccccagtcgacctgagagagtgggcc
tgcagcttgatggaccgggacaaccgcaagtctcatctgcagccacaactctctccgtcg
tcgcacgattttctaaggtccagcgatgaacctacacccacttcaggtgagattccgatt
ctggggactatggtgtcacctcgtgatcaacatggaagcgtaccaacccgacccccgcca
agcagccgaacaggcagcgctggccgcacaggtggaccgtctgtacatccgggactaggg
agccgagcagctacgactggctctcagcccagatacccgcagcaggctcctcctcctcct
catcctccgttcgaaaagaggccctccatgtcaaccggccattcgtataccagttcctcg
tcctcgagccgatcgggcttcgccctacccatccgaccggggcctccgggccagccgatg
ccgccgccgcccccacgaagacagttgacagcggaggaactgcagagggaaagtcgccga
caagccgcaatgcagcctccaactggccgattttga

DBGET integrated database retrieval system