KEGG   Neurospora crassa: NCU04726Help
Entry
NCU04726          CDS       T01034                                 

Definition
(RefSeq) beta-N-acetylglucosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ncr  Neurospora crassa
Pathway
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCU04726
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NCU04726
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    NCU04726
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NCU04726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VI; VI
AA seq 1067 aa AA seqDB search
MLIMGWDGTEVTPQIRELITDHHLGSILLTAKNLKSAHQTAKLVQELQTIAHNAGHPYPL
LIALDQENGGVNSLFDEEHICQFPSSMGQAAAGSPDLSYQLAKATATEVSACGVNLILGP
VLDVLTNARYQPLGVRATSDDPQEVSQYGIAAMKGYKDAGVATCGKHFPSYGNLDFLGSS
LDIPIITQTLEELALSALVPFRNAIATGKLDAMFVGGCGITNPSMKVAHACLSEQVVDEL
LREELGFTGVAISECLEMEALRTEMGVRTGTIMAVQAGCDLVLLCRAYDVQLEAISGLKL
GLENEVLTKERVYTSLRRVLKMKRGCTDWAKALNPPGISLLKQIHPSHLALSMKAYDDSI
TVMRDNEKLLPLNESMHQEEELLLLTPLVKPLPASAMTKTILEGSTKIRSENPIHDKWIH
RERSAIMSGEGVFRELGRSLARARHGKLLHTSYTANGVRPVHESLIQRASTIILLTADAN
RNLYQAGFTKHVAMMCSLLKASGHKKNLIVVAVSSPYDFAMDKSIGTYICTFDFTETAMS
ALVRALCGAFTPHGTLPGTLRKAPRKAVQSSAGGKSKTRTQHWLVEPYDVERDTKGLQDL
LFAMVRGSAPNHQYFYAFGPHSFSLLSDMMMVEQQHEEEPKMEEQHFVVRNSSTGALYGF
CSTYYLPSTFTGIIGAIFVDPSKRNLSIGYSLHRRAVRNLLQKHPDIKHFQLGCCLPGIF
PGIPLDHSDALSMSSAITPGSTTSSTAASSGLKSWLSTTCGWDLSPSSSSVVRTRKIYNL
LLPSLQTWSSPPDLPTTLQLAGISFDLIPGGGGSSGRTTNSTPNSSLSAEQESVLSFVSS
HSTPEILTLYRLALLQSPPLFSSSALSYSSVSSASPTDPTTYNNNHHNNNHNNTWIIRAK
IQSQSQSQSQSQSSQAPGVVEGGGGGAGGGAEQVIGTIIISSDLGRELHLPSLSSASGSS
SGGTGGIIAPVVSSMTGQQQQQQQQQANLLLVLQGLVMLGLRQNKREKMACCLLSWVSNG
NGSGGSGSRDGGQQQNNSVETLLGMGFEVQQVWEEVVNGVEQFASLA
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcatgggctgggacggcaccgaagtaaccccccaaatccgtgagctcataaca
gaccaccacctgggctccatcctcctaacagccaagaacctcaaatccgcccatcaaaca
gcaaagctcgtccaagagctccaaaccatcgcccacaacgccggccatccttaccccctg
ctcatcgccctcgaccaagaaaacggcggcgtcaactccctctttgacgaagaacacatc
tgccagttcccttcctccatgggccaagcagcagccggctccccggacctctcctaccaa
ctagccaaagcaaccgccaccgaagtctcagcctgcggcgtcaacctcatcctcggcccc
gttttggacgtccttaccaacgcgcgctaccaacctttaggcgtccgcgccacctccgac
gacccgcaagaagtctcgcagtatggaattgccgccatgaaggggtacaaagacgctggc
gtcgccacgtgcgggaaacattttccctcttacggcaacctggattttctgggaagtagt
ttggatatccccatcatcacgcagacgcttgaagaactggcgctgtcagcgctggtgccg
ttccgcaacgcgattgccacgggaaagttggacgccatgtttgtcggcggttgtgggatc
acgaatccgagcatgaaggtggcgcatgcgtgtttgagcgagcaagtggttgatgagctt
ttgcgcgaagagctggggttcactggggttgcgatatcagagtgtttggagatggaagcg
cttcgtaccgagatgggggtacgaacggggaccatcatggctgtgcaggccgggtgtgat
ttggtgttgttgtgcagggcgtatgatgtccagctggaggcgatttctggactgaagctg
gggttggagaacgaggtgttgaccaaggagagggtttatacgagtttgagaagggtgttg
aagatgaagagggggtgtacggattgggccaaggcgctgaatccgccggggatctcgctg
ctgaagcagattcacccgagccatctggcgttgagcatgaaggcgtacgatgactcgatt
acggtgatgagggacaacgaaaagttgttgccgctcaatgaaagcatgcatcaggaggag
gaactgctgcttttgacgccgctggtcaagccgttgccggcgtcggcgatgacgaagact
atcctcgaaggttcgaccaagattaggtccgagaatccgattcatgataaatggatacac
agggaacgcagtgccatcatgagtggtgagggagtgtttagggaacttgggagatctcta
gcccgcgctagacatggaaagttacttcacacttcttataccgccaacggtgtgcggccg
gtccacgaatccctcatccaacgcgcctcaaccatcatcctcctcaccgctgacgccaac
aggaacctctaccaagccggcttcaccaaacacgtagcaatgatgtgttccctcctcaaa
gcctcgggccacaaaaagaacctcatcgtcgtcgccgtctcctctccctacgacttcgcc
atggacaagtccatcggcacctacatctgcaccttcgacttcaccgaaaccgccatgtct
gccttggtccgcgccctatgcggcgctttcaccccgcacggcactttgccaggaaccctc
cgcaaagctccccgcaaggccgtccaaagctccgcaggcggcaaatccaaaacccgcacg
cagcactggctcgtcgagccctacgacgtcgaaagagacaccaaaggactccaagatcta
ctattcgccatggtccgcggcagcgcgcccaaccatcaatacttttacgccttcggcccg
cactccttctcgctgttatccgacatgatgatggtggagcagcagcacgaagaagaacca
aagatggaagagcagcactttgtcgtccgcaactcctccaccggcgctttatacgggttt
tgctccacttactacctcccctccactttcacaggaatcatcggcgccatcttcgtcgac
ccgtccaaacgtaacctgtcgatagggtactccctccaccgccgggccgtgaggaacctc
ctccagaaacacccagacatcaagcatttccagctgggatgctgtctccctggtattttc
cccggtatcccactcgaccactctgatgccctgtccatgtcgtcagctataacccctgga
tctaccacatcttccaccgccgcttcttctggtctaaaatcctggttatccactacctgc
ggatgggatttgtccccttcctcctcgagcgttgtccgcacccgcaaaatctacaacctc
ctcctcccctctctccaaacctggtcctcacccccagatttgcccaccaccctccagttg
gccggtatctccttcgacctcatccccggcggcggcggcagcagtgggcgcaccacaaat
tcaaccccaaattcatctctgtctgcagaacaagaatccgtcctctctttcgtctcatcc
cactctacccccgaaatcctcactctctacagacttgctcttcttcaatcccctcctctt
ttctcatcttctgctttgtcatattcttctgtttcttctgcttcccctactgatcctacc
acgtacaataacaatcaccataacaacaaccataacaacacatggatcatccgcgccaag
atccaatcccaatcccagtcccagtcccagtcccagtcctcccaagccccaggagtagta
gaaggaggaggaggaggagcaggaggaggagcagagcaagtaataggtaccatcataatc
agcagcgatctaggaagggagttgcatctcccttctttgtcgtcggcttcggggtcttct
agcggtggcaccgggggaatcattgcgcctgttgtgtcatccatgacggggcagcaacag
caacagcaacaacaacaggcaaacttgttgttggtgttgcaggggttggtgatgttgggg
ttgagacagaacaagagggagaagatggcttgttgcttgttgagttgggtgagcaatggc
aatggaagtggtggaagtggatcaagggatgggggacagcagcaaaacaatagtgtggaa
acgttgttgggtatgggatttgaggtacagcaggtttgggaggaggtggttaatggggtt
gagcagtttgcttcgcttgcttaa

DBGET integrated database retrieval system