KEGG   Neurospora crassa: NCU04782Help
Entry
NCU04782          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 1135 aa AA seqDB search
MADEQLRAEELQQSVMMSEHQAEASTADGDVAMVNQVTITSDMSNIIAKPEPSEADEDQE
MHDAQEENDHHDEEMGEGDDAEHSDQGSHDGHDDHDHHEDSGDEHGEEEEHDGEDPEGFD
EDAEGDEGDSVHSEEHTSQQHLPSVEEDHDDDEDDDDEGVGAVKIKPGDTDHSESESEEE
EDDHSKTKTTTRPRNSRSILHVQDVETTCAREANALASDQALDAWKCPNCASEEGSQTAA
GKNHEPTQVNGTETITHPTTRRASAPKLARDLLPPQKHTNPDSHSVFNQLVLDEDPMDGS
RVLRKRKTSSVEPPEHIISLRKRRRNTVGTEEEPDESTAGYDEQARPTSARSLRIKISNP
AAPVNIVKKTRSSILLRMRVDPTKLQQITSQPPKGDSKRSSRSARSGRSGRSGRSGRKTS
GRSGRSRRAAAAADAMEPSTAPFASTSYTQPFYSFYDKETDELKGKPYGGILTDAEADTS
KTLPQPEDRRRFDEAKQMAEEEWRQRLLKMQAEIEAPVKKSKKTAGPASQIECIEFGGWE
IDTWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHGSISV
FEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYDQYGYHFVGYFSKEKRA
SSQNNVSCILTLPIHQRKGYGNLLIDFSYLLTRVEQKTGSPEKPLSDMGLVSYRNYWRLV
MCKYLLEHCSGDPKEKKGLSIKKISDDTGLTPDDVISSLEGLRCLVRDPQTQLYAFRVDL
PYCREYVAKWEAKKYVQLEPKALTWTPYVMGRSNATNFELGPALNAIAPREDDETKPTVE
EGTVLNGNASQPDGLANQVEKMEIDTSAPTILESTEPNELGIIQPEVISPRSVLKTNGLF
PNGSVHGSVHPNDDHDRKAKTEPDADGEDKENPDDWMAQYEGIPPTRFEVVPPVNTSRRG
AGVDRIRNTVARLPAVRTNSGSAARPRNPRRTSGVRRVSSAIKPRSSSSSKRKAGGTGRG
PGRWPKGTKKSDYGNAESGPGFPPGWLAKQKSLDSTTPKKEGEEGMRDTVHVTPTAESAA
GYNMSGSGSGSGSRSANSSGANGNGEDAGSADNGDSFNGGGEDEQADITMKDDDN
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaacagctcagggcggaggagctgcagcagagcgtcatgatgtcggaacac
caggctgaggccagtaccgctgacggggacgtcgcaatggtcaaccaagtcactattacc
tccgacatgtccaacatcatcgccaagcccgagcctagcgaggccgacgaagaccaagag
atgcacgatgcacaggaagagaacgaccaccacgacgaggaaatgggcgaaggcgacgat
gccgaacactcggaccaaggcagccacgacggccatgatgaccacgaccaccacgaagac
tccggtgatgagcacggcgaagaagaggaacacgacggtgaagaccccgaggggttcgat
gaggatgccgagggagacgagggcgactccgtccactccgaggaacatacctcgcaacaa
cacctaccaagcgtggaggaggatcatgacgatgacgaggacgacgatgacgagggtgtc
ggtgccgtcaagataaaaccgggtgacactgaccatagcgaaagtgaaagcgaggaggag
gaagacgaccattccaagacgaagaccacgacccggccgaggaattcgaggagtatcttg
catgtgcaggatgtggagacaacgtgtgcaagggaagcgaatgcgttggccagtgatcaa
gcactcgacgcctggaaatgtccgaattgcgccagtgaagaagggtcacaaaccgctgcg
gggaagaatcacgagccgacgcaggtgaacgggacggaaacaattacccaccccaccaca
cgccgagcgtcagcacccaaactggctagggaccttctgcctcctcaaaaacacacaaac
ccggactcccactccgtcttcaaccagctcgtgctggacgaggatcctatggatggatcc
cgcgtacttaggaaacgtaagacgtcttcagtagaacccccagagcacataatcagcctt
aggaagcgacgccggaacaccgtgggcaccgaagaagaacccgatgagagcacagccggc
tacgacgaacaagcgaggccgacatcggcccggtcattgcgaattaagatctccaatcct
gcagccccggtcaacatcgtcaagaagacacgaagcagcatcttgctgcgcatgcgtgta
gatcccaccaagttacagcagataacatcgcaaccacccaagggggacagcaagcgatca
agccggtctgctcgatcaggtcgatccggccgttcaggacggtctgggcgtaaaacgtca
ggaagatcaggtcggtcgcgcagggcggccgcagcagctgatgcaatggaaccttccacg
gcaccgttcgctagcacaagctatacccagccattttattccttctacgataaggagacg
gacgaactcaaaggaaagccatacggtggcatcctcaccgacgccgaggcggatacgtcc
aagacactacctcaacccgaggatcgtcggcgattcgatgaagcgaagcaaatggccgag
gaggaatggcgacaacgactcctgaagatgcaagccgagatcgaggcaccagtcaagaag
tccaagaagacggccggtccagccagccaaatcgagtgcatcgagttcggaggctgggag
atcgacacatggtatgccgcaccatatcctgaggaatacagcaggaaccgggttctatat
atctgcgaattctgcctcaagtacatgaactccgactatgtggcatggagacataagctt
aagtgccccgcaaaacacccaccaggcgacgagatttatcgccatggctcgatatccgtc
ttcgaggtcgacggacgcaaaaatccggtctactgccagaatctctgcttgctggccaag
ctcttccttgggtccaagaccctctattacgacgtggagccatttctcttctacgtcctc
tgtgaatatgaccaatatggctaccatttcgtcggatacttctccaaggaaaagcgggcg
agtagtcagaacaacgtctcgtgtattctcaccttgcctatccaccaacgaaagggatac
ggtaatctcctgatcgacttctcctatctcctcaccagggtcgagcaaaagactggctcc
ccagaaaagcctctttccgacatgggcctcgtgtcttaccggaactactggaggttggtg
atgtgcaagtacctccttgagcactgctccggtgatcccaaggagaagaaaggtctgagt
atcaagaagatctccgatgacacgggccttacgccagacgacgtcatctcatcactggag
ggcttgagatgtttggtgcgcgatccccagacccaactttatgccttccgcgtcgaccta
ccttactgccgggagtacgtcgcaaagtgggaggccaagaaatacgttcagctggaacca
aaagccctcacatggactccctacgttatgggccggagcaatgccacgaactttgagctt
ggaccagcactaaacgccatcgcccctagggaggacgacgagaccaagccaacggttgaa
gaaggaaccgttctcaacggtaatgcttctcagcctgacggtctggcaaatcaggtcgaa
aagatggagattgacacctcagctccaaccattctcgagtcaaccgagcctaacgagctg
ggtatcatccagcccgaagtcatctcccctcgatctgtcctcaaaaccaacggtctcttc
cccaatggctccgtccacggttctgtccaccccaacgatgaccacgaccggaaagctaag
accgagccggacgccgatggcgaagataaagagaaccccgacgactggatggctcaatac
gagggcatcccgcctactcgctttgaggtcgttccaccggtcaacacttcccggcgcggg
gccggcgtcgaccgcatccgaaacactgttgcccgcctaccagccgttcgcaccaacagc
ggcagcgccgcccggccacgaaatcctcgccgcacgagcggtgtccgccgcgtatcttca
gccatcaagccccgcagtagcagcagcagcaagcgcaaagcaggtggcaccggtcgcggg
cctggccgttggcccaagggcaccaagaagagcgactacggtaacgccgagagtgggccg
ggttttcctcctggttggttggcgaagcagaaatcgctcgattctacgacgccgaagaag
gagggcgaggaggggatgagggatacggtgcatgttacccctactgcggagagcgccgcc
ggttacaacatgagcggtagtggcagtgggagtgggagccggagtgccaactcttctggc
gcgaacggaaacggagaggacgctgggagtgccgataacggcgacagctttaatggcggc
ggagaagacgaacaagcagatattaccatgaaggatgacgacaattag

DBGET integrated database retrieval system