KEGG   Neurospora crassa: NCU04782Help
Entry
NCU04782          CDS       T01034                                 

Gene name
hat-6
Definition
(RefSeq) histone acetyl transferase-6
  KO
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCU04782 (hat-6)
Chromosome [BR:ncr03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NuA3 complex
     NCU04782 (hat-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VI; VI
AA seq 1188 aa AA seqDB search
MADEQLRAEELQQSVMMSEHQAEASTADGDVAMVNQVTITSDMSNIIAKPEPSEADEDQE
MHDAQEENDHHDEEMGEGDDAEHSDQGSHDGHDDHDHHEDSGDEHGEEEEHDGEDPEGFD
EDAEGDEGDSVHSEEHTSQQHLPSVEEDHDDDEDDDDEGVGAVKIKPGDTDHSESESEEE
EDDHSSASSASVSDAESEDEVHWEDAAEHEPAGDEDDDDEGSEKGDSGLCMFCKQDEDHD
PAEEFEEYLACAGCGDNAHQQCAREANALASDQALDAWKCPNCASEEGSQTAAGKNHEPT
QVNGTETITHPTTRRASAPKLARDLLPPQKHTNPDSHSVFNQLVLDEDPMDGSRVLRKRK
TSSVEPPEHIISLRKRRRNTVGTEEEPDESTAGYDEQARPTSARSLRIKISNPAAPVNIV
KKTRSSILLRMRVDPTKLQQITSQPPKGDSKRSSRSARSGRSGRSGRSGRKTSGRSGRSR
RAAAAADAMEPSTAPFASTSYTQPFYSFYDKETDELKGKPYGGILTDAEADTSKTLPQPE
DRRRFDEAKQMAEEEWRQRLLKMQAEIEAPVKKSKKTAGPASQIECIEFGGWEIDTWYAA
PYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHGSISVFEVDGRK
NPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYDQYGYHFVGYFSKEKRASSQNNVS
CILTLPIHQRKGYGNLLIDFSYLLTRVEQKTGSPEKPLSDMGLVSYRNYWRLVMCKYLLE
HCSGDPKEKKGLSIKKISDDTGLTPDDVISSLEGLRCLVRDPQTQLYAFRVDLPYCREYV
AKWEAKKYVQLEPKALTWTPYVMGRSNATNFELGPALNAIAPREDDETKPTVEEGTVLNG
NASQPDGLANQVEKMEIDTSAPTILESTEPNELGIIQPEVISPRSVLKTNGLFPNGSVHG
SVHPNDDHDRKAKTEPDADGEDKENPDDWMAQYEGIPPTRFEVVPPVNTSRRGAGVDRIR
NTVARLPAVRTNSGSAARPRNPRRTSGVRRVSSAIKPRSSSSSKRKAGGTGRGPGRWPKG
TKKSDYGNAESGPGFPPGWLAKQKSLDSTTPKKEGEEGMRDTVHVTPTAESAAGYNMSGS
GSGSGSRSANSSGANGNGEDAGSADNGDSFNGGGEDEQADITMKDDDN
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaacagctcagggcggaggagctgcagcagagcgtcatgatgtcggaacac
caggctgaggccagtaccgctgacggggacgtcgcaatggtcaaccaagtcactattacc
tccgacatgtccaacatcatcgccaagcccgagcctagcgaggccgacgaagaccaagag
atgcacgatgcacaggaagagaacgaccaccacgacgaggaaatgggcgaaggcgacgat
gccgaacactcggaccaaggcagccacgacggccatgatgaccacgaccaccacgaagac
tccggtgatgagcacggcgaagaagaggaacacgacggtgaagaccccgaggggttcgat
gaggatgccgagggagacgagggcgactccgtccactccgaggaacatacctcgcaacaa
cacctaccaagcgtggaggaggatcatgacgatgacgaggacgacgatgacgagggtgtc
ggtgccgtcaagataaaaccgggtgacactgaccatagcgaaagtgaaagcgaggaggag
gaagacgaccattcgtcggcaagttcggcgagcgtcagtgatgcggaatccgaggacgag
gtacactgggaagatgcggctgagcacgaacctgcgggcgacgaggacgatgatgacgag
ggttccgaaaagggcgatagtgggctttgcatgttctgcaagcaagacgaagaccacgac
ccggccgaggaattcgaggagtatcttgcatgtgcaggatgtggagacaacgcccaccag
cagtgtgcaagggaagcgaatgcgttggccagtgatcaagcactcgacgcctggaaatgt
ccgaattgcgccagtgaagaagggtcacaaaccgctgcggggaagaatcacgagccgacg
caggtgaacgggacggaaacaattacccaccccaccacacgccgagcgtcagcacccaaa
ctggctagggaccttctgcctcctcaaaaacacacaaacccggactcccactccgtcttc
aaccagctcgtgctggacgaggatcctatggatggatcccgcgtacttaggaaacgtaag
acgtcttcagtagaacccccagagcacataatcagccttaggaagcgacgccggaacacc
gtgggcaccgaagaagaacccgatgagagcacagccggctacgacgaacaagcgaggccg
acatcggcccggtcattgcgaattaagatctccaatcctgcagccccggtcaacatcgtc
aagaagacacgaagcagcatcttgctgcgcatgcgtgtagatcccaccaagttacagcag
ataacatcgcaaccacccaagggggacagcaagcgatcaagccggtctgctcgatcaggt
cgatccggccgttcaggacggtctgggcgtaaaacgtcaggaagatcaggtcggtcgcgc
agggcggccgcagcagctgatgcaatggaaccttccacggcaccgttcgctagcacaagc
tatacccagccattttattccttctacgataaggagacggacgaactcaaaggaaagcca
tacggtggcatcctcaccgacgccgaggcggatacgtccaagacactacctcaacccgag
gatcgtcggcgattcgatgaagcgaagcaaatggccgaggaggaatggcgacaacgactc
ctgaagatgcaagccgagatcgaggcaccagtcaagaagtccaagaagacggccggtcca
gccagccaaatcgagtgcatcgagttcggaggctgggagatcgacacatggtatgccgca
ccatatcctgaggaatacagcaggaaccgggttctatatatctgcgaattctgcctcaag
tacatgaactccgactatgtggcatggagacataagcttaagtgccccgcaaaacaccca
ccaggcgacgagatttatcgccatggctcgatatccgtcttcgaggtcgacggacgcaaa
aatccggtctactgccagaatctctgcttgctggccaagctcttccttgggtccaagacc
ctctattacgacgtggagccatttctcttctacgtcctctgtgaatatgaccaatatggc
taccatttcgtcggatacttctccaaggaaaagcgggcgagtagtcagaacaacgtctcg
tgtattctcaccttgcctatccaccaacgaaagggatacggtaatctcctgatcgacttc
tcctatctcctcaccagggtcgagcaaaagactggctccccagaaaagcctctttccgac
atgggcctcgtgtcttaccggaactactggaggttggtgatgtgcaagtacctccttgag
cactgctccggtgatcccaaggagaagaaaggtctgagtatcaagaagatctccgatgac
acgggccttacgccagacgacgtcatctcatcactggagggcttgagatgtttggtgcgc
gatccccagacccaactttatgccttccgcgtcgacctaccttactgccgggagtacgtc
gcaaagtgggaggccaagaaatacgttcagctggaaccaaaagccctcacatggactccc
tacgttatgggccggagcaatgccacgaactttgagcttggaccagcactaaacgccatc
gcccctagggaggacgacgagaccaagccaacggttgaagaaggaaccgttctcaacggt
aatgcttctcagcctgacggtctggcaaatcaggtcgaaaagatggagattgacacctca
gctccaaccattctcgagtcaaccgagcctaacgagctgggtatcatccagcccgaagtc
atctcccctcgatctgtcctcaaaaccaacggtctcttccccaatggctccgtccacggt
tctgtccaccccaacgatgaccacgaccggaaagctaagaccgagccggacgccgatggc
gaagataaagagaaccccgacgactggatggctcaatacgagggcatcccgcctactcgc
tttgaggtcgttccaccggtcaacacttcccggcgcggggccggcgtcgaccgcatccga
aacactgttgcccgcctaccagccgttcgcaccaacagcggcagcgccgcccggccacga
aatcctcgccgcacgagcggtgtccgccgcgtatcttcagccatcaagccccgcagtagc
agcagcagcaagcgcaaagcaggtggcaccggtcgcgggcctggccgttggcccaagggc
accaagaagagcgactacggtaacgccgagagtgggccgggttttcctcctggttggttg
gcgaagcagaaatcgctcgattctacgacgccgaagaaggagggcgaggaggggatgagg
gatacggtgcatgttacccctactgcggagagcgccgccggttacaacatgagcggtagt
ggcagtgggagtgggagccggagtgccaactcttctggcgcgaacggaaacggagaggac
gctgggagtgccgataacggcgacagctttaatggcggcggagaagacgaacaagcagat
attaccatgaaggatgacgacaattag

DBGET integrated database retrieval system