KEGG   Neurospora crassa: NCU04997Help
Entry
NCU04997          CDS       T01034                                 

Gene name
gh10-3
Definition
(RefSeq) glycosylhydrolase family 10-3
  KO
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     NCU04997 (gh10-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VI; VI
AA seq 431 aa AA seqDB search
MHLPTVLSVIFAAAGVTAQLNDLAVAAGLKYFGTAGQEGTITSDTTYRNIINNVHEFGQL
TPENGMKWDATEGQPGKFTFQSGDIVAGVAKSNGQLLRCHTLVWYSQLPSWVSNGSWNRN
TLQSVIESHISNVMGHYKGQCYAWDVVNEAISDDAQGNYRDSIFFKTFKTDYFPIAFNAA
KKADPNAKLYYNDYNLEYNGAKTERALELVKLIKAAGAPIDGVGFQAHMTVGGTPSRSAM
ATLLKRFTALGVEVAYTELDIAHKNQPSSSSVQAQQATDYANMVGSCVDVDGCVGVTIWG
FIDKYNWIQNGNAAIFDSSFNKKPAYSAISSVLAAAATKAPTPAKNANSPPAVHTTLRTA
IATAPACEATATAPKATAAPAAQPAKPATGSSTGAQQPRWAQCGGNGYTGPTACQAPYTC
KVQNPWYSQCL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcatctccccaccgttctttctgtcatcttcgctgcggccggcgttaccgcccagctc
aacgatctcgccgtcgctgccggtctcaagtactttggtactgctggccaggaaggcacc
atcacctcggataccacttaccgtaacatcatcaacaacgtgcacgagttcggccagctc
actcccgagaacggcatgaagtgggatgccaccgagggccaacccggaaagttcaccttc
caatcgggagatattgttgctggagtggccaagagcaacggacagctcttgagatgccac
acgctggtttggtacagccagctgccttcgtgggtctccaacggctcctggaaccgtaac
acccttcagtccgttatcgagtcgcacattagcaatgttatgggccactacaagggccag
tgctacgcctgggatgttgtgaacgaggccatctccgatgatgctcaaggcaactaccgc
gattcgatcttcttcaagaccttcaagacggattacttccccattgccttcaatgctgcg
aagaaggctgatcccaacgccaagctctactacaacgactacaacctcgagtacaacggc
gccaagaccgaaagggcccttgagctcgtcaagctcatcaaggctgccggcgcccccatt
gatggtgtcggtttccaggcccatatgactgtcggcggcacgccctcgcgcagtgccatg
gccaccctcctcaagcgttttaccgctctcggtgttgaggttgcctataccgagctcgac
attgcgcacaagaaccagccctcctcctcctcggtccaggcccaacaggctaccgactat
gccaacatggttggctcctgcgtggacgtcgacggctgcgtcggtgtcaccatctggggc
ttcatcgacaagtacaactggatccagaacggtaacgctgcgatcttcgatagcagcttc
aacaagaagcccgcctattccgctatcagctccgtcttggccgctgcggcgacgaaagcc
cctactccggccaagaacgccaactcccctcctgctgtgcacacgaccctcaggaccgcg
attgcgactgctcctgcctgtgaggcgaccgccactgcccccaaggccacggcggcgcct
gctgcccagccggctaagccggccaccggttcctctactggcgcgcagcagccgcgttgg
gcgcagtgcggtggtaacggatacacgggccccactgcttgccaggccccgtatacttgc
aaggttcagaacccttggtatagccagtgcttgtaa

DBGET integrated database retrieval system