KEGG   Neurospora crassa: NCU05078Help
Entry
NCU05078          CDS       T01034                                 

Definition
protein-beta-aspartate methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NCU05078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 235 aa AA seqDB search
MAWYSSGGSNAELVENLWRNGLIKEERVKEAFLKVDRAHYAPTSPYSDSPQPIGHAATIS
APHMHATAIEHLLPSLLPSPSRPAPRVLDIGSGSGYLTHVLAELVGSEGGTVVGLEHIPA
LRDLGARNMAKSAEGRDFLETGRVRFRVGDGRKGMGEDKDEGKWDAIHVGASAKEIHKEL
IDQLRSPGRMFVPVDDDEMGLGQHVWLVQKGEDGEVSKRRLFGVRYVPLGDPPRA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtactcatcgggcggaagcaacgcggagctggtggagaatttgtggaggaat
gggttgattaaggaggagagggtgaaggaggcttttttgaaggtcgacagagcccactac
gcccccacctccccttactccgactccccccaacccatcggccacgccgccaccatctcc
gccccccacatgcacgccaccgcaatcgaacacctcctgccctccctcctgccctccccc
tcccgcccggcccctcgtgtcctcgacatcggctcggggtcaggctacctcacgcacgtg
ctcgccgagctcgtcggttccgaaggcggcaccgtcgtcggtctcgaacacattccggcc
ttgcgcgacctcggcgcgcgcaacatggccaagtccgctgaaggccgcgactttctcgag
acaggccgggtgcggttccgtgtgggtgatgggcggaagggaatgggggaggataaggat
gaagggaagtgggatgcgattcatgtgggggcgtcggcgaaggagatacataaggagttg
atcgatcaactgaggagtccgggacggatgtttgtgcctgttgatgatgatgagatggga
ctggggcagcatgtgtggttggtgcagaagggggaggatggggaggttagtaagaggaga
ttgtttggggtgaggtatgtgcctttgggggatccgcctcgggcttga

DBGET integrated database retrieval system