KEGG   Neurospora crassa: NCU05185Help
Entry
NCU05185          CDS       T01034                                 

Definition
bifunctional P-450:NADPH-P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ncr  Neurospora crassa
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    NCU05185
  Amino acid metabolism
   00380 Tryptophan metabolism
    NCU05185
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NCU05185
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     NCU05185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 1108 aa AA seqDB search
MSSDETPQTIPIPGPPGLPLVGNSFDIDTEFPLGSMLNFADQYGEIFRLNFPGRNTVFVT
SQALVHELCDEKRFQKTVNSALHEIRHGIHDGLFTARNDEPNWGIAHRILMPAFGPMAIQ
NMFPEMHEIASQLALKWARHGPNQSIKVTDDFTRLTLDTIALCSMDYRFNSYYHDDMHPF
IDAMASFLVESGNRSRRPALPAFMYSKVDRKFYDDIRVLRETAEGVLKSRKEHPSERKDL
LTAMLDGVDPKTGGKLSDDSIIDNLITFLIAGHETTSGLLSFAFVQLLKNPETYRKAQKE
VDDVCGKGPIKLEHMNKLHYIAAVLRETLRLCPTIPVIGVESKEDTVIGGKYEVSKGQPF
ALLFAKSHVDPAVYGDTANDFDPERMLDENFERLNKEFPDCWKPFGNGMRACIGRPFAWQ
EALLVMAVCLQNFNFMPEDPNYTLQYKQTLTTKPKGFYMRAMLRDGMSALDLERRLKGEL
VAPKPTAQGPVSGQPKKSGEGKPISIYYGSNTGTCETFAQRLASDAEAHGFTATIIDSLD
AANQNLPKDRPVVFITASYEGQPPDNAALFVGWLESLTGNELEGVQYAVFGCGHHDWAQT
FHRIPKLVDNTVSERGGDRICSLGLADAGKGEMFTEFEQWEDEVFWPAMEEKYEVSRKED
DNEALLQSGLTVNFSKPRSSTLRQDVQEAVVVDAKTITAPGAPPKRHIEVQLSSDSGAYR
SGDYLAVLPINPKETVNRVMRRFQLAWDTNITIEASRQTTILPTGVPMPVHDVLGAYVEL
SQPATKKNILALAEAADNAETKATLRQLAGPEYTEKITSRRVSILDLLEQFPSIPLPFSS
FLSLLPPMRVRQYSISSSPLWNPSHVTLTYSLLESPSLSNPDKKHVGVATSYLASLEAGD
KLNVSIRPSHKAFHLPVDADKTPLIMIAAGSGLAPFRGFVQERAAQIAAGRSLAPAMLFY
GCRHPEQDDLYRDEFDKWESIGAVSVRRAFSRCPESQETKGCKYVGDRLWEDREEVTGLW
DRGAKVYVCGSREVGESVKKVVVRIALERQKMIVEAREKGELDSLPEGIVEGLKLKGLTV
EDVEVSEERALKWFEGIRNERYATDVFD
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagacgaaacaccacaaacgatccccatccccggaccccccgggctgcccctg
gtgggcaactcttttgacattgacaccgagttcccacttgggtccatgctcaactttgcc
gaccagtatggcgaaatcttccgtctcaacttccccggcagaaacaccgtctttgtgact
tcccaagctctcgtccacgagctctgtgatgaaaagcgattccaaaagacggtcaattcc
gccctccacgaaatccgacacggcatccacgatggcctcttcaccgcccgcaacgacgag
cccaactggggcatcgcccaccgaatcctcatgccggcctttggccccatggccatccag
aacatgttccccgagatgcacgagattgccagccagctcgccctcaagtgggcccgccac
ggccccaaccagtccatcaaggtgaccgacgacttcacccgcctgaccctcgacaccatc
gccctgtgctccatggactaccgcttcaactcgtactaccacgacgacatgcaccccttt
atcgacgccatggccagcttcctcgtcgagtccggcaaccgctcgcgacgcccggcgctt
ccggccttcatgtacagcaaggtcgaccgcaagttctacgacgacatccgggtcctccgt
gaaaccgccgagggcgtcctcaagtccagaaaggagcacccttccgagcgcaaagatcta
ctgacggccatgttggacggcgtcgaccccaagacgggcgggaagctcagcgacgacagc
atcatcgacaacctcatcacctttttgatcgcgggccacgaaaccacgtcgggtctcctg
agcttcgcctttgtccagctgctcaagaaccccgagacctaccgcaaggcccaaaaggaa
gtcgacgacgtgtgcggcaagggccccatcaagctcgagcacatgaacaagctgcactac
atcgccgccgtcctgcgcgagaccctccgtctctgccccaccattcccgtgattggcgtc
gagtccaaggaggacaccgtcattggcggcaagtacgaggtttccaagggccagcctttt
gccctgctcttcgccaagtcccacgtcgacccggccgtctatggagataccgccaacgac
tttgaccccgagcgcatgctggacgagaactttgagcgcttgaacaaggagttccccgac
tgctggaagccgtttggcaacggcatgcgcgcctgcatcggtcgtccgtttgcgtggcag
gaggcgttgctggtcatggcggtgtgcctgcaaaacttcaactttatgcctgaggatccc
aactatacgctgcagtacaagcagaccttgaccaccaagcccaagggcttctacatgcgc
gccatgctgcgcgacggcatgtctgctctggacctggagcgccgtctgaagggtgagctt
gtggctcccaagcctactgcccagggacccgtgtcgggacagcccaagaagagcggagag
ggcaagcctatcagcatctactacggctccaacacgggcacttgcgagacctttgctcag
cgccttgcttccgatgccgaggcgcacgggttcacggcgacgattatcgactccttggat
gcggccaaccagaacctgcccaaggacaggccggtggtcttcatcactgcctcgtacgag
ggccaaccccctgacaatgcggctttgttcgtcggctggctcgagagcttgactggtaac
gagctcgagggtgtccagtacgctgtctttggctgcggtcatcacgattgggcgcagacc
ttccatcgcattcccaagctggtcgacaacaccgtgtccgagcgcggcggcgatcgtatc
tgttcgttgggtctcgccgacgccggcaagggcgagatgtttaccgagttcgagcagtgg
gaggacgaggtgttctggcctgccatggaagaaaagtacgaagttagcaggaaggaggat
gacaacgaggctttgcttcaatctggccttaccgtcaacttttccaagcctcgctcttct
accttgaggcaagacgtccaggaagccgtggttgtcgacgccaagaccatcaccgccccg
ggtgctcctcccaagcgccacatcgaggtccagctctcgtccgactcgggcgcctaccgc
tctggcgattaccttgccgttctgcccatcaacccgaaggagacggtcaaccgcgtcatg
cgccgcttccaactggcgtgggacaccaacatcaccatcgaggcgtcccggcagaccacc
attttgcccaccggcgtgcccatgccggttcacgacgtcctgggcgcctacgttgagctc
tcccagccggccaccaagaaaaacatcctcgctctcgccgaagccgccgacaacgccgag
accaaggccacactgcgccagttggcaggacccgaatacacggaaaagatcacctcgcgc
cgcgtctccatcctcgacctgctcgagcagttcccgtccatcccgctgcccttctcctcc
ttcctctctttgctgccacccatgcgtgtgaggcagtactccatctcctcgtctccgctc
tggaacccgtcgcacgttaccctgacctactcccttctcgaaagcccttccttgtcgaac
cccgacaagaaacacgtcggcgtggcgaccagttacttggccagcttggaggcaggcgac
aagttgaatgtgtctatccgcccttcgcacaaggccttccacctgccggtagacgccgac
aagactcccctgatcatgattgctgctggttctggcctggcgccgtttagaggcttcgtg
caggaacgcgcggcgcagattgctgcaggtcggagtctggcgcccgccatgctgttctac
gggtgtcgccatccggagcaggacgacttgtaccgtgacgagttcgacaagtgggaatcc
atcggcgccgtgtcggtccggagggcattcagtcggtgcccggagagccaagagaccaag
gggtgcaagtacgttggcgatcggctgtgggaggatcgcgaggaagtgacgggattgtgg
gaccggggggccaaggtctatgtctgtggaagcagggaggtcggggagagtgtgaagaag
gtggtggtcaggattgcgttggagaggcagaagatgattgtcgaggcgagggagaagggt
gagcttgacagtttgccggaggggattgtggagggactgaagctgaagggtttgacggtg
gaggatgtcgaggtcagtgaggagagggcgttgaagtggtttgaggggatcaggaatgag
aggtatgccactgatgtgtttgactga

DBGET integrated database retrieval system