KEGG   Neurospora crassa: NCU05218Help
Entry
NCU05218          CDS       T01034                                 

Definition
histone acetyltransferase ESA1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCU05218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 506 aa AA seqDB search
MSPPGGDATVGSDEKRQKGKATPDTIKMGCIAMVMKEGQLRRAEILSIKDTKSGRQFYCN
FDNFNKRLDEWVPAARIDFEQDVEWPNPDKDKQKDAKTKKNNSTVSKKQPSKKNNQKKAS
KREQSVASDGQTPHPWTEFVESQPGKNNRQRGKTEDGTDVNASLEVGGDKGVKRKADEID
MDEDEIPAAKKQRQPSFSREQEIEKLRTSGSMTQNPTEISRIRNISKVEFGRYVLFPWYF
SPYPQIFDQEDCIYICEFCLSYYGELKSFVRHRQKCTLHHPPGNEIYRDDYVSFFEIDGR
RQRTWCRNLCLLSKMFLDHKTLYYDVDPFLFYVMTTRDDRGCHIIGYFSKEKESTDGYNV
ACILTLPQYQRKGYGRLLIQFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWSENIIDILL
GYNERKEACTIENIAVALAMTTQDVEHTLQALKMQVYHKGEHKIVVPEKLIKQREKSKAK
QKRLIDPERIQWKPPVFTALNRTWGW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtcccccaggtggcgatgccactgtcggctccgacgagaagcgacagaagggcaag
gcgacgcccgacaccatcaaaatgggatgtattgccatggtgatgaaagaaggccaatta
cgacgagcagagatcctcagtatcaaagacaccaagtccggccggcaattctactgcaac
tttgacaacttcaacaagcgtctcgacgaatgggtgccggccgccagaatcgatttcgag
caggacgtcgagtggcccaacccggacaaggacaagcagaaggacgccaagaccaagaaa
aacaactcgacggtatccaagaagcaaccgtccaagaagaacaaccagaaaaaggccagc
aagagggagcagtcagtcgcatcggacgggcagacaccacacccatggaccgagtttgtc
gaaagccagccagggaagaataacaggcaacgggggaagacggaagatggaaccgacgtc
aacgccagtttggaggttggtggggacaagggagtcaagaggaaagccgacgagatcgat
atggatgaggacgaaataccagccgctaagaaacaacgccagccgtctttttccagggaa
caagagattgaaaagttgcgaacatccggctccatgacacagaaccctaccgagatctcg
cgcattcggaatatctccaaggtggaattcggccgctacgtcctcttcccgtggtatttc
tcgccctacccgcagatctttgaccaagaagactgcatctacatctgcgagttctgtctc
tcgtactacggcgagttgaaatcctttgtgcgtcaccgacaaaagtgcactctacaccac
ccgcccggaaacgaaatctaccgggacgactacgtctcctttttcgaaatcgacgggcga
cgtcagcgcacctggtgtcgcaacctctgcttgctgtccaagatgtttctcgaccacaaa
accctttactacgatgtcgacccgtttttgttctacgtcatgaccacccgcgacgaccgg
gggtgccacatcatcgggtacttctccaaagaaaaagagtctacggacggctacaacgtc
gcctgtatcttgacccttccgcagtaccaacgcaagggatacggtcgcctgctcatccaa
ttctcgtacgaactgtccaaaatcgaaggcaagctcggctcgcccgagaagcccctgtcc
gatctgggtctgctgtcatatagacagtattggtccgagaacatcatcgatatcttgctc
gggtacaacgagcgaaaggaagcttgcacgattgagaacattgctgttgccctggccatg
acgacacaggatgtggaacatacgttgcaggcgctcaagatgcaggtgtaccacaagggc
gagcacaagattgtggtaccggagaagctgatcaagcagagggagaagagcaaagcgaag
caaaagaggctgattgatcccgagaggatccagtggaagccaccggtgttcacggcgctt
aatcggacatgggggtggtag

DBGET integrated database retrieval system