KEGG   Neurospora crassa: NCU05259Help
Entry
NCU05259          CDS       T01034                                 

Definition
acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ncr  Neurospora crassa
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NCU05259
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NCU05259
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NCU05259
Lipid biosynthesis proteins [BR:ncr01004]
 Desaturase
  First
   NCU05259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 477 aa AA seqDB search
MASTSATDIPAEVQAVNVPDGTTDFIPLRGKKYDLKKPHITELPITWGNWYKHVNWLNTT
FIIFVPLAGLISAYWIPAQTKTILFSIAYYYFAGLGITAGYHRLWAHTSYKATLPLKIWL
AAGGAAAVEGSARWWSRDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMVMKQNPKRIGRTD
ITDLNEDPVVVWQHKHYIKCVIVMALIVPTLICGLGWGDYAGGFIYGGILRIFFIQQATF
CVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDFRNAIEWWQYDPTKW
CIWVWKQLGLAYDLKKFPHNEIEKGRLQQQQKKLDQKRATLDWGIPLENLPVVSWDDFVQ
ESKNGKAWIAVAGVIHDVGKFIQDHPGGKALINSAIGKDATAIFNGGVYNHSNAAHNLLS
TMRVGVIRGGCEVEIWKRAQAENKDIATVTDSSGKKIVRAGLQPTRVTPPVTTADAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacttcggccacggatattcctgctgaggttcaggctgtgaatgtccctgat
ggcaccaccgatttcatccccctcagaggcaagaagtatgacctcaagaagcctcacatt
accgagctgcccatcacctggggcaactggtacaagcacgtcaactggttgaacaccacc
ttcatcatcttcgtgcctctcgccggtctcatctctgcctactggatccccgctcagacc
aagaccatcctcttctctatcgcctactactacttcgccggtctcggtatcactgccggt
taccaccgactttgggcccacacctcttacaaggccaccctccccctcaagatctggctc
gccgctggtggtgctgctgccgtcgagggttccgcccgctggtggtccagggaccaccgt
gctcaccacagatacaccgataccgacaaggacccctactcggtccgcaagggtctcctc
tactcccacatcggctggatggtcatgaagcagaaccccaagagaatcggccgtaccgac
atcaccgatctcaacgaggaccccgtcgtcgtttggcagcacaagcactacatcaagtgc
gtcatcgtcatggctctcatcgtccctacccttatttgcggtctcggctggggtgactat
gctggtggcttcatctacggcggtatcctccgtatcttcttcatccagcaggctaccttc
tgcgtcaactctcttgcccactggctcggcgaccagcccttcgacgaccgcaactcaccg
agagatcacgtcatcactgccctcgtcacccttggtgagggttaccacaacttccaccac
gagttccccagcgatttccgtaacgctattgagtggtggcaatatgaccccaccaagtgg
tgcatctgggtctggaagcagctcggtctcgcctacgacctcaagaagttcccccacaac
gagatcgagaagggccgtctccagcagcagcagaagaagctcgaccagaagcgtgccacc
cttgactggggtattccccttgagaacctccccgttgtcagctgggacgactttgtccag
gagtccaagaacggcaaggcctggatcgctgtcgctggtgtcatccacgatgtcggcaag
ttcattcaggaccaccctggtggcaaggctcttatcaactcggctattggcaaggacgct
accgccatcttcaacggtggtgtctacaaccactccaacgctgcccacaaccttctctcc
accatgcgcgtcggtgtcatccgcggcggctgcgaggttgagatctggaagcgtgcccag
gccgagaacaaggatattgccactgttaccgactcttctggcaagaagatcgttagagct
ggccttcaacctactcgtgtcaccccacccgtcaccacggctgatgcggcatga

DBGET integrated database retrieval system