KEGG   Neurospora crassa: NCU05429Help
Entry
NCU05429          CDS       T01034                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ncr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
II
AA seq 741 aa AA seqDB search
MNDISDNSSNSLANGGTVANSDIPKDGTGVLSIDPWLEPFKDTLKSRYSKAQSWIDTINK
TEGGLEKFSRGTEIFGFNVDKDNTITYREWAPNAKQASLIGEFNNWDRNAHRMKKNEFGV
FEITIPPTANGQPAIPHNSKIKITLELPDGQWVDRLPAWIKYVTQDLSVSPAYEARFWNP
PQSERYTFKHKRPSKPESLRIYEAHVGISSPECKVATYKEFTKTMLPRIKNLGYNAIQLM
AIMEHAYYASFGYQVNSFFAASSRYGPPEDLKELVDTAHAMGIAVLLDVVHSHASKNVLD
GLNEFDGTDHQYFHGGGRGKHDLWDSRLFNYGHHEVMRFLLSNLRFWMDEYAFDGFRFDG
VTSMLYLHHGIGTGFSGGYHEYFGPDVDEEAVVYLMLANEMLHQLYPNVITVAEDVSGMP
ALCLPLSLGGVGFDYRLAMAIPDMWIKILKEKKDEEWDMANITWTLTNRRHGEKTIAYCE
SHDQALVGDKTLMMHLCDAELYTNMSILTPLTPVIDRGMALHKMIRLLTHSLGGEGYLNF
EGNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDGLLRYQYLNNFDRSMNLTEDKYGWLH
APQAYISLKHEGDKVIVFERAGLVFVFNFHPSNSYTDYRIGIEQAGTYRIVLDSDTKEHG
GFNRLDPQTRFFTSDLPWNNRKNSTHVYIPARTAFRPGEGHKRRKASLCKSSAFVVIVAL
ICVLLKPAAAKVLVEMVGDDV
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatctcagacaactcttccaactcgctggccaacggcggcaccgttgccaac
agcgacattcccaaggatggcaccggtgtcttgagcattgacccctggctcgagccgttc
aaggataccctcaagagccgctattccaaggcccaatcctggatcgataccatcaacaag
acagagggcggtttggagaagttcagcaggggtaccgaaatctttggtttcaacgtcgac
aaggacaacaccatcacatacagagaatgggctcccaatgccaaacaagcctccctcatt
ggcgaatttaacaactgggataggaacgcccaccgcatgaagaagaacgagttcggcgtc
tttgagatcacaattcctcccacggccaacgggcaaccagctattccccacaactccaag
atcaagatcaccctcgagctccccgacggccaatgggtcgacagattgccagcatggatc
aaatatgtcacccaggacctctcagtctcgcccgcatacgaggcgcggttctggaaccct
ccccaatccgaacgatacacattcaagcacaagaggccctcaaagccggagagccttagg
atctacgaggcccacgtcggcatttcctccccggagtgcaaggtggctacctataaggag
ttcaccaagaccatgcttcctcgcatcaagaacctgggatacaacgccattcagctcatg
gccatcatggagcacgcctactatgccagtttcggatatcaggtgaacagctttttcgcg
gcaagcagcagatacggcccgcccgaggatctcaaggagttggtggataccgcccacgcc
atgggtattgccgtgttgctcgatgtcgtccacagtcacgcctccaagaacgtccttgat
ggcttgaatgagtttgacggtactgaccaccagtacttccacggcggcggcaggggcaag
catgatctttgggacagcaggcttttcaactacggtcatcacgaggtcatgaggttcttg
ctcagcaaccttaggttctggatggatgagtacgcctttgatggcttcagatttgatggt
gtgacaagtatgctttacctccatcacggtatcggaactggtttctctggtggctaccac
gagtacttcggccctgatgttgatgaggaggcggtcgtttacctcatgctcgccaatgag
atgcttcaccaactataccccaacgtcattacggttgccgaggatgtatcaggaatgccg
gctctgtgtctcccactatccttaggaggtgttggcttcgactacagactcgccatggcc
attcccgacatgtggatcaagatcctgaaggagaagaaggacgaggaatgggatatggcc
aatattacctggaccttgacaaacaggcgtcacggcgagaagaccattgcttactgtgag
agtcacgatcaagcgctcgtcggtgacaagaccctcatgatgcatctctgcgatgccgag
ttgtacaccaacatgtctatcctcacgcctctaaccccggtcattgaccgcggcatggca
ctgcacaagatgatccgtctccttacccattccctgggaggtgagggttacctcaacttc
gagggcaacgagttcggccaccccgagtggcttgacttcccccgtgagggcaaccagaac
tctttctggtacgccaggcgccagctcaaccttacggaagatggtcttttgcgttaccag
tacctcaacaactttgacaggtcgatgaacctgaccgaggacaagtatggctggttgcac
gccccacaggcctacatctctctcaagcacgagggcgataaggttattgtctttgagcgc
gccggcttggtctttgtcttcaacttccacccctccaacagctacaccgactaccgcatc
ggtattgagcaggcgggcacctaccgcatcgttctcgactctgataccaaggagcacggt
ggcttcaaccgtctcgatccccagactcgcttcttcacttcggaccttccgtggaacaac
cgcaagaacagcacccatgtgtacattccggccaggacagcctttcggccgggtgaaggc
cacaagcgtaggaaagcatcactttgcaagtcttctgcttttgttgtcattgtggcgttg
atttgcgtgttgttgaagccagctgctgctaaagtgttggttgagatggttggtgacgac
gtatag

DBGET integrated database retrieval system