KEGG   Neurospora crassa: NCU05429Help
Entry
NCU05429          CDS       T01034                                 

Definition
(RefSeq) 1,4-alpha-glucan branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU05429
Enzymes [BR:ncr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NCU05429
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCU05429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group II; II
AA seq 705 aa AA seqDB search
MNDISDNSSNSLANGGTVANSDIPKDGTGVLSIDPWLEPFKDTLKSRYSKAQSWIDTINK
TEGGLEKFSRGTEIFGFNVDKDNTITYREWAPNAKQASLIGEFNNWDRNAHRMKKNEFGV
FEITIPPTANGQPAIPHNSKIKITLELPDGQWVDRLPAWIKYVTQDLSVSPAYEARFWNP
PQSERYTFKHKRPSKPESLRIYEAHVGISSPECKVATYKEFTKTMLPRIKNLGYNAIQLM
AIMEHAYYASFGYQVNSFFAASSRYGPPEDLKELVDTAHAMGIAVLLDVVHSHASKNVLD
GLNEFDGTDHQYFHGGGRGKHDLWDSRLFNYGHHEVMRFLLSNLRFWMDEYAFDGFRFDG
VTSMLYLHHGIGTGFSGGYHEYFGPDVDEEAVVYLMLANEMLHQLYPNVITVAEDVSGMP
ALCLPLSLGGVGFDYRLAMAIPDMWIKILKEKKDEEWDMANITWTLTNRRHGEKTIAYCE
SHDQALVGDKTLMMHLCDAELYTNMSILTPLTPVIDRGMALHKMIRLLTHSLGGEGYLNF
EGNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDGLLRYQYLNNFDRSMNLTEDKYGWLH
APQAYISLKHEGDKVIVFERAGLVFVFNFHPSNSYTDYRIGIEQAGTYRIVLDSDTKEHG
GFNRLDPQTRFFTSDLPWNNRKNSTHVYIPARTAFVLALESTLSE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatctcagacaactcttccaactcgctggccaacggcggcaccgttgccaac
agcgacattcccaaggatggcaccggtgtcttgagcattgacccctggctcgagccgttc
aaggataccctcaagagccgctattccaaggcccaatcctggatcgataccatcaacaag
acagagggcggtttggagaagttcagcaggggtaccgaaatctttggtttcaacgtcgac
aaggacaacaccatcacatacagagaatgggctcccaatgccaaacaagcctccctcatt
ggcgaatttaacaactgggataggaacgcccaccgcatgaagaagaacgagttcggcgtc
tttgagatcacaattcctcccacggccaacgggcaaccagctattccccacaactccaag
atcaagatcaccctcgagctccccgacggccaatgggtcgacagattgccagcatggatc
aaatatgtcacccaggacctctcagtctcgcccgcatacgaggcgcggttctggaaccct
ccccaatccgaacgatacacattcaagcacaagaggccctcaaagccggagagccttagg
atctacgaggcccacgtcggcatttcctccccggagtgcaaggtggctacctataaggag
ttcaccaagaccatgcttcctcgcatcaagaacctgggatacaacgccattcagctcatg
gccatcatggagcacgcctactatgccagtttcggatatcaggtgaacagctttttcgcg
gcaagcagcagatacggcccgcccgaggatctcaaggagttggtggataccgcccacgcc
atgggtattgccgtgttgctcgatgtcgtccacagtcacgcctccaagaacgtccttgat
ggcttgaatgagtttgacggtactgaccaccagtacttccacggcggcggcaggggcaag
catgatctttgggacagcaggcttttcaactacggtcatcacgaggtcatgaggttcttg
ctcagcaaccttaggttctggatggatgagtacgcctttgatggcttcagatttgatggt
gtgacaagtatgctttacctccatcacggtatcggaactggtttctctggtggctaccac
gagtacttcggccctgatgttgatgaggaggcggtcgtttacctcatgctcgccaatgag
atgcttcaccaactataccccaacgtcattacggttgccgaggatgtatcaggaatgccg
gctctgtgtctcccactatccttaggaggtgttggcttcgactacagactcgccatggcc
attcccgacatgtggatcaagatcctgaaggagaagaaggacgaggaatgggatatggcc
aatattacctggaccttgacaaacaggcgtcacggcgagaagaccattgcttactgtgag
agtcacgatcaagcgctcgtcggtgacaagaccctcatgatgcatctctgcgatgccgag
ttgtacaccaacatgtctatcctcacgcctctaaccccggtcattgaccgcggcatggca
ctgcacaagatgatccgtctccttacccattccctgggaggtgagggttacctcaacttc
gagggcaacgagttcggccaccccgagtggcttgacttcccccgtgagggcaaccagaac
tctttctggtacgccaggcgccagctcaaccttacggaagatggtcttttgcgttaccag
tacctcaacaactttgacaggtcgatgaacctgaccgaggacaagtatggctggttgcac
gccccacaggcctacatctctctcaagcacgagggcgataaggttattgtctttgagcgc
gccggcttggtctttgtcttcaacttccacccctccaacagctacaccgactaccgcatc
ggtattgagcaggcgggcacctaccgcatcgttctcgactctgataccaaggagcacggt
ggcttcaaccgtctcgatccccagactcgcttcttcacttcggaccttccgtggaacaac
cgcaagaacagcacccatgtgtacattccggccaggacagcctttgtccttgcgctcgag
tccaccctttcagagtag

DBGET integrated database retrieval system