KEGG   Neurospora crassa: NCU05523Help
Entry
NCU05523          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ncr  Neurospora crassa
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NCU05523
  Replication and repair
   03420 Nucleotide excision repair
    NCU05523
Transcription machinery [BR:ncr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NCU05523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 475 aa AA seqDB search
MSLGGQQLLEYLEKLPGTAFRRLYQSPATALAIFRRMLSYHEGGGKIHRDRTIAALRSLH
ILQVSPPSKDRTQEIQITASFKKGLQLAFEGGGEDGSFGVPSSLPVDPSIDIAYLDRYAR
KKWDDILHYVVNSLGVHGSSEGVSGPKASVKELLLAGRLVERRPDTRTGIGITQAGFTFL
LQESNAQVWTLLLLWLEAADHTADSGMDSIDMLSFLFMLSSLELGTAYDTSALTETRRNM
LPSLVDFGLIYFPRDTRQFFPTRLATTLTSTASALRTVSSAFTAATANPSGEPGTTTSTS
GGPAATPDKTQTAAKGIIIETNYRIYAYTTSPLQIAVLALFCQLNMRFPNMVSGRLTRDS
IRQAIGFGITADQIISYLHAHAHQQMVREATVTGKPVLPPTVVDQIRLWQLENERMQTTA
GFLFKDFESTEEYAALSRYAEEIGVLVWKNDKRQLFFASKHEQLRDYLKSRKKGE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcggcggacaacagctcctcgagtacttggagaagctgccaggtacagctttt
aggagactgtaccagtcaccagcgacagctttggccatcttccgccgtatgctgtcttat
catgagggcggcggaaagatacatcgcgatcgcaccattgccgctctccgatccctccac
atcctacaggtctcaccaccaagcaaggaccgaacccaagaaatccaaatcacggcgagc
ttcaagaaaggcctacaactagccttcgaagggggcggcgaagatggcagctttggcgtc
cctagttctcttcccgtcgatccctccatcgacatcgcctacctggacaggtacgctcgt
aagaagtgggacgacatcctccactacgttgtcaacagtcttggggtccacggcagctca
gaaggggtcagcggacccaaggccagtgtgaaggaactactcttggccggacgcctcgtc
gaacgacgtccagacacccgtacaggaatcggaattacgcaagccggtttcaccttcctt
ctccaggagtccaacgcccaagtatggacgctcctcctcctctggctcgaagcagccgac
cacacggccgactcgggcatggacagcattgacatgctctccttcctcttcatgctcagc
tcgcttgagcttggaactgcctacgatacttcggccctgaccgagacgcggcggaatatg
cttccctcgctcgtcgacttcgggctcatctacttcccgcgcgacacgcgccagtttttc
cctacccgcctggccaccacactgaccagtaccgcctcggccctgcgcaccgtctcctcg
gctttcacggccgcaaccgccaacccctcgggcgagcccggcaccacgaccagcaccagc
ggcggccccgccgccacccccgacaaaacacagacagcagccaagggcatcatcatcgag
accaactatcgtatctacgcctacaccacctccccgctacaaatcgccgtcctggctctc
ttctgccagctcaacatgcgtttccccaacatggtctcgggccgcctaacccgcgactcc
atccgccaagcaatcggcttcggcatcaccgccgaccaaatcatttcctacctacacgcg
catgctcatcaacaaatggtgcgcgaagccacggtcacgggtaaaccggtgcttcccccg
acggtggtggaccagatcaggctttggcagctggagaacgaaaggatgcagaccacggcg
ggcttcttgttcaaggactttgagagcacggaggagtacgcggcgctgagcaggtatgcg
gaggagattggcgtactagtgtggaagaatgataagaggcagctcttttttgccagcaag
catgagcagttgagggattatttgaagagtcggaagaagggggagtaa

DBGET integrated database retrieval system