KEGG   Neurospora crassa: NCU05523Help
Entry
NCU05523          CDS       T01034                                 

Definition
(RefSeq) transcription factor tfb2
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ncr  Neurospora crassa
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NCU05523
  Replication and repair
   03420 Nucleotide excision repair
    NCU05523
Transcription machinery [BR:ncr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NCU05523
DNA repair and recombination proteins [BR:ncr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     NCU05523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VI; VI
AA seq 501 aa AA seqDB search
MSLGGQQLLEYLEKLPGTAFRRLYQSPATALAIFRRMLSYHAKVIVRGLLYMPDPFPLTS
LDIWFPPEGGGKIHRDRTIAALRSLHILQVSPPSKDRTQEIQITASFKKGLQLAFEGGGE
DGSFGVPSSLPVDPSIDIAYLDRYARKKWDDILHYVVNSLGVHGSSEGVSGPKASVKELL
LAGRLVERRPDTRTGIGITQAGFTFLLQESNAQVWTLLLLWLEAADHTADSGMDSIDMLS
FLFMLSSLELGTAYDTSALTETRRNMLPSLVDFGLIYFPRDTRQFFPTRLATTLTSTASA
LRTVSSAFTAATANPSGEPGTTTSTSGGPAATPDKTQTAAKGIIIETNYRIYAYTTSPLQ
IAVLALFCQLNMRFPNMVSGRLTRDSIRQAIGFGITADQIISYLHAHAHQQMVREATVTG
KPVLPPTVVDQIRLWQLENERMQTTAGFLFKDFESTEEYAALSRYAEEIGVLVWKNDKRQ
LFFASKHEQLRDYLKSRKKGE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcggcggacaacagctcctcgagtacttggagaagctgccaggtacagctttt
aggagactgtaccagtcaccagcgacagctttggccatcttccgccgtatgctgtcttat
catgccaaggttattgtccgaggtctactgtacatgcccgacccattcccgttaacctcc
cttgacatatggttccctccagagggcggcggaaagatacatcgcgatcgcaccattgcc
gctctccgatccctccacatcctacaggtctcaccaccaagcaaggaccgaacccaagaa
atccaaatcacggcgagcttcaagaaaggcctacaactagccttcgaagggggcggcgaa
gatggcagctttggcgtccctagttctcttcccgtcgatccctccatcgacatcgcctac
ctggacaggtacgctcgtaagaagtgggacgacatcctccactacgttgtcaacagtctt
ggggtccacggcagctcagaaggggtcagcggacccaaggccagtgtgaaggaactactc
ttggccggacgcctcgtcgaacgacgtccagacacccgtacaggaatcggaattacgcaa
gccggtttcaccttccttctccaggagtccaacgcccaagtatggacgctcctcctcctc
tggctcgaagcagccgaccacacggccgactcgggcatggacagcattgacatgctctcc
ttcctcttcatgctcagctcgcttgagcttggaactgcctacgatacttcggccctgacc
gagacgcggcggaatatgcttccctcgctcgtcgacttcgggctcatctacttcccgcgc
gacacgcgccagtttttccctacccgcctggccaccacactgaccagtaccgcctcggcc
ctgcgcaccgtctcctcggctttcacggccgcaaccgccaacccctcgggcgagcccggc
accacgaccagcaccagcggcggccccgccgccacccccgacaaaacacagacagcagcc
aagggcatcatcatcgagaccaactatcgtatctacgcctacaccacctccccgctacaa
atcgccgtcctggctctcttctgccagctcaacatgcgtttccccaacatggtctcgggc
cgcctaacccgcgactccatccgccaagcaatcggcttcggcatcaccgccgaccaaatc
atttcctacctacacgcgcatgctcatcaacaaatggtgcgcgaagccacggtcacgggt
aaaccggtgcttcccccgacggtggtggaccagatcaggctttggcagctggagaacgaa
aggatgcagaccacggcgggcttcttgttcaaggactttgagagcacggaggagtacgcg
gcgctgagcaggtatgcggaggagattggcgtactagtgtggaagaatgataagaggcag
ctcttttttgccagcaagcatgagcagttgagggattatttgaagagtcggaagaagggg
gagtaa

DBGET integrated database retrieval system