KEGG   Neurospora crassa: NCU05608Help
Entry
NCU05608          CDS       T01034                                 

Definition
phosphatidylinositol 3-kinase tor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ncr  Neurospora crassa
Brite
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   NCU05608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 2509 aa AA seqDB search
MSLTKEQAAATLETYIRDVRNRTSSDDARKRAARQIRDLVNVAKQGKSTNSEFLLRFLSD
IGTHANIQGCIEMGAEQFTAFFNTVNQRTMALIQGTDTCDRMGGVYILDALVDFDGIDLA
LKYSRFEQHIGYILRSKDVTPMQPAAVVLGKLCKPGGSLISELVDAEVKLALEWLQSERV
EERRYAAVLILRELARNAPTLMYPYVNFVFEQSWIGLRDQRLLIRATSAETVSACFKIIR
ERDQAMKQEWMDKMFHEAVRGLKTNTVESVHASLLVLKELLEQGGMYMQTHYGEACDIVF
RHKDAKDPAIRKTVVLLIPDLANYAPNDFASTYLHKFMIHLSHMLKKEKERNDAFLAIGN
VANSVKSAIAPYLDDVLIYVRDGLSIQSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALL
DPIFACELTPKLTQALVDMAFYIPPVKATIQERLLDMLSKVLCGEPFRPLGAPHPNTLTS
IPAIPKDPKDPSVQERGKAEVKLALNTLGSFDFSGHVLNEFVRDVAIKYVEDDDPEIREA
AALTCCQLYVRDPIVNQTSYHALQVVADVIEKLLTVGVSDPDPGIRRTVLAALDERFDQH
LAKAENIRTLFFALHDEQFAIREVAVSIIGRLARYNPAYVIPQLRKTIIQMLTELEYTDV
ARSKEESSKLLSLLTQHAQDLVKPYVNSITEVLLPKARDPTPSVAATVLQAIGELCTVGG
ESMLAYKDTLMPIIIDALQDQSAPIKREAALHTLGQLASNAGYVIKPYLEYPQLLEILQS
IIRGEPQHGTLRQETIKLMGILGALDPYKHQASPAKDSMASQVANVASARSGNPSNKTPD
SLKTALTNLMQVEERTDDNKRNNEAAQLTDVSLMMGGLTPSNEDYYPTVVINALLQILKD
QSLVQWHGNVVDAIMSIFITLGLKCVQFLDRVVPAFISVIRASSNARLEFYFNHLSRLVS
IVRQHIRVYLKDIIDVLQEYWHTTLALQSTILGLIESISRSLEGEFKIYLAKLLPLMLGV
LEKDVSTKRQPSEKVFHAFLVFGSSAEEYMHLIIPVIVRLFDSHSQPLFLRKSAIETIGK
LSSMVNLNDYASKIIHPLTRVLASGEPSLRVAALDTLCALMLQLGRDYLHFEHTVDKAIS
MYAIQHSNYEKAIEKLKKGEALPQNLAPRFEDISMEGFAAENNPPKKLTLNPVHLKQVWE
TKGKSTKDDWHEWFRKFSTTLLTESPNHSLRACASLASNYQPLARELFNSAFVSCWSELY
EQFQEDLITNIENTIKSENVPPDLLGQLLNLAEFMEHDDKALPIDIRVLGREAARCHAYA
KALHYKELEFLQDHNSGAVEALIVINNQLQQSDAAIGILRKVKTYREGIQLRESWFEKLE
RWDEALNFYCQREREIPEDQPVPVDIVMGKMRCYHALGEWDSLATLAGKTWANSAPEIQR
RIAPLATTAAWGLGKWDSMDSYLQSMKRFSPDRAFFGAILALHRNQFREAMACIEQAREG
LDTELSALVSESYNRAYQVVVRVQMLAELEELIVYKQCDGEKQATMRRTWETRLKGCQRN
VEVWQRMLRLRSLVMTPQENMHMWTKFANLCRKSGRMGLAEKSLKQLIGTDSPLDSVIPY
WHDRHPGSVGNRIASPILYAVLKFQWEIGQSPGFRNSEHRVAEKTLYCLQRFTQETAHRV
ETSRMHMAAHAQNGMEVQNQPGFAEFNEEMMHPQAQKHWLEQTVLLAKCYLRQGEWMVSL
NKDDWQQRYRAEVLDCYYKATHYNNKWYKAWHAWALANFEVVQYLTGNREVDVRNNGEQN
YIIQYVVPAVRGFFESIALSSGSSLQDTLRLLALWLTHGGHIDVHNAVTEGFTRVSVDTW
LEVIPQLIARINQPHKRVQQSVHGLLADVGRAHPQALVYPLTVARKSWHNTRRVRSANQI
LESMRQHSLRLVEQAEIVSGELIRVAVLWHELWHEALEEASRLYFGDHNIEGMFATLEPL
HELLEAGPQTLREISFAQTFGRDLSEARDWCRQYQETQDSNDLNQAWDLYYTVFRRITRQ
LPQMTSLELAYCSPNLLNAKDLELAVPGTYRSGQEVVRIMSFDATFSVISSKQRPRKLDI
VGSDGKTYTFLLKGHEDIRQDERVMQLFGLCNTLLANDSECFKRHLNIQRYPAIPLSQNS
GLLGWVPNSDTVHQLIREYRDSRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNT
TGQDLYRVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKII
HIDFGDCFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRTTCEHVMRVLRENKESV
MAVLEAFIHDPLLNWRLTNPTSPPGPNFNAEREVAMPGGPGPRARRPSILDAPVAPTEFL
AAQAAPGADGHGMGMSANPGRSRARTNSSAIYPTGSSMVNGHGNNQQEQQEVQNARALEV
LDRVQQKLTGRDFKPHEELNVTDQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7530 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacaaaggagcaagcagcggcaacgctggaaacatacattcgcgatgtgagg
aatcgcacctctagcgacgacgcgcggaagcgcgctgctcggcagatcagagatttggta
aacgttgcgaagcaaggcaagtccaccaattccgagtttctcctcagattcctgtcagat
attggaacacatgctaacatacaaggctgtatagaaatgggcgcggagcagtttacggcc
tttttcaacacagtcaaccaaaggaccatggcgcttatacaagggaccgacacgtgtgac
cggatgggcggtgtttacatcctcgatgctttggtcgacttcgatggtatcgacctagcc
ctcaagtacagtcgcttcgagcagcacattggctacatcctccgcagcaaagacgtaaca
ccaatgcagcccgccgcggtcgtcttgggaaagctttgcaaacctggcggctctctgatc
tcagagcttgttgatgccgaggtcaagctggctctggaatggctccagtcagagcgagtt
gaagaaaggcgatatgccgccgtccttattctacgcgagctggcacgcaacgcacccact
ctcatgtacccgtacgttaacttcgtctttgagcagtcctggatcggcctccgagatcag
cgactgttgatccgagccacttctgccgagacagtcagtgcctgcttcaagattattagg
gaacgtgatcaggccatgaagcaggagtggatggacaagatgttccatgaagccgtcagg
ggactcaagacaaacactgtcgagtcagtccatgcttctctcttggttctcaaggagctg
ctagagcagggtggcatgtacatgcaaacccactacggcgaggcatgcgatatcgtcttc
cgtcacaaggacgccaaggacccggctattcgtaagacggtggtcctcctcatcccggac
ttggccaactacgcaccgaacgactttgcatcaacatatctgcacaagtttatgattcat
ctttctcatatgcttaagaaggaaaaggaaaggaacgatgcctttctcgctattggtaac
gttgccaactcagtcaagagcgccatcgctccctatctcgatgacgtcctcatatatgtt
cgagacggcctaagtatacagtcacggaagcgaggttcggtcgaccccgtcttcgattgt
attagccgtttggccgtggccgtaggtcagacattgagcaaatatatggaggcgctcctg
gatccaatcttcgcctgcgagctcaccccgaaactaacccaggctttggttgacatggcc
ttctacattcccccagtcaaggctaccatccaggaacggttgctcgatatgctcagcaag
gttttgtgtggagaaccattccgaccgctaggagcaccgcatcccaacacactcacttcg
atcccggccatcccaaaagatcccaaggatccatcagtgcaggagcgaggaaaggccgag
gtcaaattggctttgaacaccctcggcagttttgatttttcaggacatgtcttgaacgag
ttcgtccgcgacgttgcgatcaaatacgttgaagatgacgatccggaaatccgtgaggca
gctgctctcacctgctgtcagctttacgtgcgcgaccccattgtcaaccagacaagttac
catgccctccaggtggtcgcagatgttattgagaagctcttgacagtcggagtttcggat
ccggatcccggcatcagacgcactgttctggccgccctcgacgagcgcttcgatcagcac
ctagccaaagctgagaatatccggaccttgtttttcgccctccacgacgaacaattcgcc
atcagagaagttgcggtttcgatcatcggacgtctggctcgttacaacccggcctacgtc
attccacagttgcgtaagaccattattcagatgctaacggaactggaatacacggatgtg
gccaggagtaaagaggagagttccaagttgctcagtctgcttacgcagcatgcccaggac
ttggtcaagccctacgtgaactccataaccgaggttctcttaccaaaagcgcgtgatccc
acgccttctgtggctgcaactgtccttcaggcgattggcgagttgtgcacggtcggcggt
gaatcgatgcttgcttacaaggatacgttgatgcccattatcattgatgccctacaagat
cagagtgctcctatcaagcgggaagctgctctccacacactcggtcaacttgctagcaac
gctggctatgtcatcaaaccctatctcgaatatccccaacttctggagattctccagtca
atcatccgcggagagccccaacacggcacattgcgacaggagaccatcaaacttatgggc
atcctaggcgctctggacccttacaaacatcaggctagtcctgcaaaggacagtatggcc
agccaagtggccaatgtcgcgagtgcgaggagcggaaacccctcaaacaagacccccgat
tccctcaaaaccgcgttgactaacttgatgcaggtcgaagaaaggactgatgacaacaag
cggaacaatgaagccgcccaactgactgatgtctctctgatgatgggtggcctaacacca
tctaatgaagactactatccgaccgtggtgatcaacgcactgcttcagatcctgaaggat
cagtctttagtccagtggcacggaaacgttgtcgatgccatcatgagcattttcatcact
ctgggactgaagtgtgtacagttccttgatcgtgtggtccccgccttcatatcagtcatc
cgtgcgtcgagcaacgcccggcttgagttctacttcaatcacttgagcaggctggtcagt
atcgttcgccaacacatccgagtttatctcaaggacatcatcgatgttcttcaggagtac
tggcacacaactctcgcgcttcagagcactatcctggggctgatagagtcaatctcgcgg
tctcttgagggcgagttcaagatttacctcgccaagttactcccacttatgctaggcgtg
ctcgagaaggatgttagcacgaagcggcaacctagcgagaaagtgttccacgcgttcctg
gtatttggctcaagcgccgaagagtacatgcatttgataatcccagttattgtacgcctc
ttcgacagtcacagccagccattgttccttcggaaatcggctatcgagacgatcggcaag
ctttcgagcatggtgaacttgaacgactacgcgtcaaagatcatccatcctctgactcgt
gtgttggctagtggcgagccgagtcttcgggtagcggctttggacacactttgcgccctt
atgctgcaactaggacgcgactacttgcatttcgagcacacagtcgacaaggcgatctcc
atgtatgccatccagcactcgaattacgaaaaggccatcgagaagctaaagaagggcgag
gccctcccacaaaatctcgctcctcggtttgaagacatctccatggagggctttgctgcc
gaaaacaacccgcccaagaagttgaccctgaatccggtgcatctcaagcaagtgtgggaa
acaaagggcaagtccaccaaggacgattggcatgagtggttcaggaagtttagcacaact
cttcttaccgagtcgccgaaccattccttgcgtgcttgtgccagcttggccagcaactac
cagcctcttgcgcgtgagctcttcaactcggccttcgtgtcctgctggagcgagctttat
gaacagttccaggaggacttgatcaccaacattgagaatacgatcaaatcggagaacgtg
ccaccggatctccttggccagctcctcaaccttgccgagttcatggagcacgatgataag
gcgctgcctattgacataagagtattgggacgtgaggccgcacgttgccacgcatacgca
aaggctcttcactataaagagctcgagtttttgcaggaccataatagtggtgcagtggag
gctttgattgtcatcaacaaccagcttcagcaatccgatgctgccatcggtattcttcgt
aaagtcaagacctacagggagggtatccagttgcgcgagagttggttcgagaagctcgag
cgttgggacgaggccctcaacttctactgccaacgtgagcgcgaaattcccgaagaccag
cctgttcccgtcgacattgtgatgggcaagatgcgttgttatcacgctcttggcgagtgg
gattctctggctacgcttgctggaaagacctgggccaattcggcccctgaaattcagaga
cgcattgctccattggccacaaccgctgcctggggtctcggcaaatgggactcgatggac
agctaccttcagtcaatgaagcgcttctccccagatagagctttcttcggtgcgattctg
gcccttcaccgcaatcagttcagggaggctatggcatgcatcgagcaagctcgcgaagga
ctggataccgagcttagtgcgcttgttagcgagtcttacaaccgggcttatcaggttgta
gtacgcgtccagatgctcgcggagctggaagagctcattgtctacaagcaatgcgacgga
gagaagcaggctaccatgcgcagaacctgggagactcgtctcaagggctgccagcgcaat
gtcgaggtatggcaacgcatgctgcgtttgagatcgcttgtcatgactccgcaggagaac
atgcatatgtggaccaagtttgccaacctttgtcgcaagtcgggccgcatgggactcgcc
gaaaagtcactcaagcagcttattggaaccgactcgccattggactctgtcattccctac
tggcacgatcgccatccgggctcggtcggcaacagaatcgcgtctccgatcttgtatgcg
gttctgaagttccagtgggagattggacagtcaccaggattccgcaattcggagcacagg
gttgccgagaagacgctgtactgcctgcagaggttcacgcaggagactgcgcaccgcgtt
gaaacctcgcgtatgcacatggctgcccatgcacagaacggcatggaggtgcaaaaccag
ccagggtttgccgagttcaatgaagagatgatgcatccacaggcacagaaacactggctt
gagcagactgtcttgctggccaagtgctatctacgccagggtgagtggatggtctcgctg
aacaaggacgattggcagcagaggtaccgcgccgaagtccttgactgctactacaaggct
acccactacaacaacaagtggtacaaggcttggcacgcatgggctctggccaacttcgaa
gtcgttcagtacctgacaggaaaccgtgaggttgatgtgcgcaacaatggggagcagaat
tacatcattcaatacgtggtgcctgctgttcgcggattctttgaatccatcgcgctgtcc
tctggcagctctttgcaggacactctgcgcctcttggctttgtggctcacacacggtggc
cacattgatgtccataacgccgtcactgaagggtttacgcgtgttagtgttgatacctgg
cttgaggtcataccccagttgatcgccagaatcaaccagcctcacaagagggtgcagcag
tcagtccatgggttattagccgacgttggtcgtgctcacccccaggcgttggtgtatccg
ttgacagtcgcaagaaagtcctggcacaacacgcgtagggtacggtcggccaaccaaatt
cttgaaagtatgcgtcagcacagtctccggcttgttgagcaagcggagattgtcagtggt
gagctcattcgcgtcgcagtgctctggcacgagttgtggcacgaggccctcgaggaagct
tcgcgcttgtactttggcgaccacaacatcgagggcatgtttgccactctcgagccgctt
cacgagttgctggaggctggcccgcaaacccttagagagatctctttcgcccagaccttt
ggccgtgatctgagcgaagcgcgggattggtgccgtcagtatcaagagacgcaagactcc
aatgaccttaaccaggcatgggacctgtactacacggtgttccgtcgtatcacccgccaa
cttccgcagatgacctccctcgagttggcttactgctcgcctaatttgctaaacgccaag
gatctcgaacttgctgtgcccggaacgtaccgcagtggccaggaggttgttaggatcatg
tcttttgacgccaccttcagcgtgatcagctccaaacagcggcctcgcaagctcgatatc
gttggcagcgacggcaagacatacactttccttctcaagggacacgaagatatccgccaa
gatgagcgtgtcatgcagctgttcggtctttgcaatactttgttggccaacgactcggaa
tgcttcaaacgacacctcaatattcagcgatacccggctattcccctttcacagaactct
ggtcttctcggctgggtccccaacagtgacactgtccatcagttgattcgggagtacaga
gattccagaaaaattctccttaacattgagcatcgtatcatgttgcagatggctcccgac
tacgacaaccttacgcttatgcaaaaggttgaggtctttggatatgctcttgataatacc
actggccaagatctgtaccgtgtcctgtggctgaagagcaagtcttctgaggcctggctg
gatcggagaacaaactacacacgttctcttggtgtcatgtcgatggtcggctacatcctc
ggcttgggtgatcgccatcctagcaacttgatgcttgaccgtatcacgggcaagatcatc
cacattgatttcggtgactgcttcgaagtagccatgaagcgcgagaagtatcctgagcgg
gtgccgttcagactgactcgcatgctcacatatgctatggaagttagtaacatagagggt
agtttccgtaccacctgtgagcatgtgatgagggtgttgcgcgagaacaaggagagtgtc
atggctgtccttgaagctttcattcacgatcctttgctcaactggcgcttgaccaacccc
accagcccgcctggtcccaacttcaacgccgagcgagaggtcgccatgcccggtggccct
ggtccgcgcgcccgcaggccatcaatccttgacgctcccgtggcacccaccgagttcctt
gccgcgcaggctgctcctggtgcggatgggcatggaatggggatgtccgctaaccccgga
cgctcccgtgcccgcaccaattcgtctgccatctatccgactggtagcagcatggttaat
ggccatggaaacaaccagcaagagcaacaggaggttcagaacgcgcgcgccctcgaggtc
ttggaccgtgtgcagcagaagctcactggtcgcgacttcaagcctcatgaggagctcaat
gttactgatcaggtcaacaagctgatcatcgaggccaccaagcttgagaacctgtgccag
cactacataggatggtgcagtttctggtag

DBGET integrated database retrieval system