KEGG   Neurospora crassa: NCU05608Help
Entry
NCU05608          CDS       T01034                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase tor2
  KO
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ncr  Neurospora crassa
Brite
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   NCU05608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group VI; VI
AA seq 2443 aa AA seqDB search
MSLTKEQAAATLETYIRDVRNRTSSDDARKRAARQIRDLVNVAKQEMGAEQFTAFFNTVN
QRTMALIQGTDTCDRMGGVYILDALVDFDGIDLALKYSRFEQHIGYILRSKDVTPMQPAA
VVLGKLCKPGGSLISELVDAEVKLALEWLQSERVEERRYAAVLILRELARNAPTLMYPYV
NFVFEQSWIGLRDQRLLIRATSAETVSACFKIIRERDQAMKQEWMDKMFHEAVRGLKTNT
VESVHASLLVLKELLEQGGMYMQTHYGEACDIVFRHKDAKDPAIRKTVVLLIPDLANYAP
NDFASTYLHKFMIHLSHMLKKEKERNDAFLAIGNVANSVKSAIAPYLDDVLIYVRDGLSI
QSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACELTPKLTQALVDMAFYIPPV
KATIQERLLDMLSKVLCGEPFRPLGAPHPNTLTSIPAIPKDPKDPSVQERGKAEVKLALN
TLGSFDFSGHVLNEFVRDVAIKYVEDDDPEIREAAALTCCQLYVRDPIVNQTSYHALQVV
ADVIEKLLTVGVSDPDPGIRRTVLAALDERFDQHLAKAENIRTLFFALHDEQFAIREVAV
SIIGRLARYNPAYVIPQLRKTIIQMLTELEYTDVARSKEESSKLLSLLTQHAQDLVKPYV
NSITEVLLPKARDPTPSVAATVLQAIGELCTVGGESMLAYKDTLMPIIIDALQDQSAPIK
REAALHTLGQLASNAGYVIKPYLEYPQLLEILQSIIRGEPQHGTLRQETIKLMGILGALD
PYKHQVEERTDDNKRNNEAAQLTDVSLMMGGLTPSNEDYYPTVVINALLQILKDQSLVQW
HGNVVDAIMSIFITLGLKCVQFLDRVVPAFISVIRASSNARLEFYFNHLSRLVSIVRQHI
RVYLKDIIDVLQEYWHTTLALQSTILGLIESISRSLEGEFKIYLAKLLPLMLGVLEKDVS
TKRQPSEKVFHAFLVFGSSAEEYMHLIIPVIVRLFDSHSQPLFLRKSAIETIGKLSSMVN
LNDYASKIIHPLTRVLASGEPSLRVAALDTLCALMLQLGRDYLHFEHTVDKAISMYAIQH
SNYEKAIEKLKKGEALPQNLAPRFEDISMEGFAAENNPPKKLTLNPVHLKQVWETKGKST
KDDWHEWFRKFSTTLLTESPNHSLRACASLASNYQPLARELFNSAFVSCWSELYEQFQED
LITNIENTIKSENVPPDLLGQLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHYK
ELEFLQDHNSGAVEALIVINNQLQQSDAAIGILRKVKTYREGIQLRESWFEKLERWDEAL
NFYCQREREIPEDQPVPVDIVMGKMRCYHALGEWDSLATLAGKTWANSAPEIQRRIAPLA
TTAAWGLGKWDSMDSYLQSMKRFSPDRAFFGAILALHRNQFREAMACIEQAREGLDTELS
ALVSESYNRAYQVVVRVQMLAELEELIVYKQCDGEKQATMRRTWETRLKGCQRNVEVWQR
MLRLRSLVMTPQENMHMWTKFANLCRKSGRMGLAEKSLKQLIGTDSPLDSVIPYWHDRHP
GSVGNRIASPILYAVLKFQWEIGQSPGFRNSEHRVAEKTLYCLQRFTQETAHRVETSRMH
MAAHAQNGMEVQNQPGFAEFNEEMMHPQAQKHWLEQTVLLAKCYLRQGEWMVSLNKDDWQ
QRYRAEVLDCYYKATHYNNKWYKAWHAWALANFEVVQYLTGNREVDVRNNGEQNYIIQYV
VPAVRGFFESIALSSGSSLQDTLRLLALWLTHGGHIDVHNAVTEGFTRVSVDTWLEVIPQ
LIARINQPHKRVQQSVHGLLADVGRAHPQALVYPLTVARKSWHNTRRVRSANQILESMRQ
HSLRLVEQAEIVSGELIRVAVLWHELWHEALEEASRLYFGDHNIEGMFATLEPLHELLEA
GPQTLREISFAQTFGRDLSEARDWCRQYQETQDSNDLNQAWDLYYTVFRRITRQLPQMTS
LELAYCSPNLLNAKDLELAVPGTYRSGQEVVRIMSFDATFSVISSKQRPRKLDIVGSDGK
TYTFLLKGHEDIRQDERVMQLFGLCNTLLANDSECFKRHLNIQRYPAIPLSQNSGLLGWV
PNSDTVHQLIREYRDSRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQDLY
RVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKIIHIDFGD
CFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRTTCEHVMRVLRENKESVMAVLEA
FIHDPLLNWRLTNPTSPPGPNFNAEREVAMPGGPGPRARRPSILDAPVAPTEFLAAQAAP
GADGHGMGMSANPGRSRARTNSSAIYPTGSSMVNGHGNNQQEQQEVQNARALEVLDRVQQ
KLTGRDFKPHEELNVTDQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7332 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacaaaggagcaagcagcggcaacgctggaaacatacattcgcgatgtgagg
aatcgcacctctagcgacgacgcgcggaagcgcgctgctcggcagatcagagatttggta
aacgttgcgaagcaagaaatgggcgcggagcagtttacggcctttttcaacacagtcaac
caaaggaccatggcgcttatacaagggaccgacacgtgtgaccggatgggcggtgtttac
atcctcgatgctttggtcgacttcgatggtatcgacctagccctcaagtacagtcgcttc
gagcagcacattggctacatcctccgcagcaaagacgtaacaccaatgcagcccgccgcg
gtcgtcttgggaaagctttgcaaacctggcggctctctgatctcagagcttgttgatgcc
gaggtcaagctggctctggaatggctccagtcagagcgagttgaagaaaggcgatatgcc
gccgtccttattctacgcgagctggcacgcaacgcacccactctcatgtacccgtacgtt
aacttcgtctttgagcagtcctggatcggcctccgagatcagcgactgttgatccgagcc
acttctgccgagacagtcagtgcctgcttcaagattattagggaacgtgatcaggccatg
aagcaggagtggatggacaagatgttccatgaagccgtcaggggactcaagacaaacact
gtcgagtcagtccatgcttctctcttggttctcaaggagctgctagagcagggtggcatg
tacatgcaaacccactacggcgaggcatgcgatatcgtcttccgtcacaaggacgccaag
gacccggctattcgtaagacggtggtcctcctcatcccggacttggccaactacgcaccg
aacgactttgcatcaacatatctgcacaagtttatgattcatctttctcatatgcttaag
aaggaaaaggaaaggaacgatgcctttctcgctattggtaacgttgccaactcagtcaag
agcgccatcgctccctatctcgatgacgtcctcatatatgttcgagacggcctaagtata
cagtcacggaagcgaggttcggtcgaccccgtcttcgattgtattagccgtttggccgtg
gccgtaggtcagacattgagcaaatatatggaggcgctcctggatccaatcttcgcctgc
gagctcaccccgaaactaacccaggctttggttgacatggccttctacattcccccagtc
aaggctaccatccaggaacggttgctcgatatgctcagcaaggttttgtgtggagaacca
ttccgaccgctaggagcaccgcatcccaacacactcacttcgatcccggccatcccaaaa
gatcccaaggatccatcagtgcaggagcgaggaaaggccgaggtcaaattggctttgaac
accctcggcagttttgatttttcaggacatgtcttgaacgagttcgtccgcgacgttgcg
atcaaatacgttgaagatgacgatccggaaatccgtgaggcagctgctctcacctgctgt
cagctttacgtgcgcgaccccattgtcaaccagacaagttaccatgccctccaggtggtc
gcagatgttattgagaagctcttgacagtcggagtttcggatccggatcccggcatcaga
cgcactgttctggccgccctcgacgagcgcttcgatcagcacctagccaaagctgagaat
atccggaccttgtttttcgccctccacgacgaacaattcgccatcagagaagttgcggtt
tcgatcatcggacgtctggctcgttacaacccggcctacgtcattccacagttgcgtaag
accattattcagatgctaacggaactggaatacacggatgtggccaggagtaaagaggag
agttccaagttgctcagtctgcttacgcagcatgcccaggacttggtcaagccctacgtg
aactccataaccgaggttctcttaccaaaagcgcgtgatcccacgccttctgtggctgca
actgtccttcaggcgattggcgagttgtgcacggtcggcggtgaatcgatgcttgcttac
aaggatacgttgatgcccattatcattgatgccctacaagatcagagtgctcctatcaag
cgggaagctgctctccacacactcggtcaacttgctagcaacgctggctatgtcatcaaa
ccctatctcgaatatccccaacttctggagattctccagtcaatcatccgcggagagccc
caacacggcacattgcgacaggagaccatcaaacttatgggcatcctaggcgctctggac
ccttacaaacatcaggtcgaagaaaggactgatgacaacaagcggaacaatgaagccgcc
caactgactgatgtctctctgatgatgggtggcctaacaccatctaatgaagactactat
ccgaccgtggtgatcaacgcactgcttcagatcctgaaggatcagtctttagtccagtgg
cacggaaacgttgtcgatgccatcatgagcattttcatcactctgggactgaagtgtgta
cagttccttgatcgtgtggtccccgccttcatatcagtcatccgtgcgtcgagcaacgcc
cggcttgagttctacttcaatcacttgagcaggctggtcagtatcgttcgccaacacatc
cgagtttatctcaaggacatcatcgatgttcttcaggagtactggcacacaactctcgcg
cttcagagcactatcctggggctgatagagtcaatctcgcggtctcttgagggcgagttc
aagatttacctcgccaagttactcccacttatgctaggcgtgctcgagaaggatgttagc
acgaagcggcaacctagcgagaaagtgttccacgcgttcctggtatttggctcaagcgcc
gaagagtacatgcatttgataatcccagttattgtacgcctcttcgacagtcacagccag
ccattgttccttcggaaatcggctatcgagacgatcggcaagctttcgagcatggtgaac
ttgaacgactacgcgtcaaagatcatccatcctctgactcgtgtgttggctagtggcgag
ccgagtcttcgggtagcggctttggacacactttgcgcccttatgctgcaactaggacgc
gactacttgcatttcgagcacacagtcgacaaggcgatctccatgtatgccatccagcac
tcgaattacgaaaaggccatcgagaagctaaagaagggcgaggccctcccacaaaatctc
gctcctcggtttgaagacatctccatggagggctttgctgccgaaaacaacccgcccaag
aagttgaccctgaatccggtgcatctcaagcaagtgtgggaaacaaagggcaagtccacc
aaggacgattggcatgagtggttcaggaagtttagcacaactcttcttaccgagtcgccg
aaccattccttgcgtgcttgtgccagcttggccagcaactaccagcctcttgcgcgtgag
ctcttcaactcggccttcgtgtcctgctggagcgagctttatgaacagttccaggaggac
ttgatcaccaacattgagaatacgatcaaatcggagaacgtgccaccggatctccttggc
cagctcctcaaccttgccgagttcatggagcacgatgataaggcgctgcctattgacata
agagtattgggacgtgaggccgcacgttgccacgcatacgcaaaggctcttcactataaa
gagctcgagtttttgcaggaccataatagtggtgcagtggaggctttgattgtcatcaac
aaccagcttcagcaatccgatgctgccatcggtattcttcgtaaagtcaagacctacagg
gagggtatccagttgcgcgagagttggttcgagaagctcgagcgttgggacgaggccctc
aacttctactgccaacgtgagcgcgaaattcccgaagaccagcctgttcccgtcgacatt
gtgatgggcaagatgcgttgttatcacgctcttggcgagtgggattctctggctacgctt
gctggaaagacctgggccaattcggcccctgaaattcagagacgcattgctccattggcc
acaaccgctgcctggggtctcggcaaatgggactcgatggacagctaccttcagtcaatg
aagcgcttctccccagatagagctttcttcggtgcgattctggcccttcaccgcaatcag
ttcagggaggctatggcatgcatcgagcaagctcgcgaaggactggataccgagcttagt
gcgcttgttagcgagtcttacaaccgggcttatcaggttgtagtacgcgtccagatgctc
gcggagctggaagagctcattgtctacaagcaatgcgacggagagaagcaggctaccatg
cgcagaacctgggagactcgtctcaagggctgccagcgcaatgtcgaggtatggcaacgc
atgctgcgtttgagatcgcttgtcatgactccgcaggagaacatgcatatgtggaccaag
tttgccaacctttgtcgcaagtcgggccgcatgggactcgccgaaaagtcactcaagcag
cttattggaaccgactcgccattggactctgtcattccctactggcacgatcgccatccg
ggctcggtcggcaacagaatcgcgtctccgatcttgtatgcggttctgaagttccagtgg
gagattggacagtcaccaggattccgcaattcggagcacagggttgccgagaagacgctg
tactgcctgcagaggttcacgcaggagactgcgcaccgcgttgaaacctcgcgtatgcac
atggctgcccatgcacagaacggcatggaggtgcaaaaccagccagggtttgccgagttc
aatgaagagatgatgcatccacaggcacagaaacactggcttgagcagactgtcttgctg
gccaagtgctatctacgccagggtgagtggatggtctcgctgaacaaggacgattggcag
cagaggtaccgcgccgaagtccttgactgctactacaaggctacccactacaacaacaag
tggtacaaggcttggcacgcatgggctctggccaacttcgaagtcgttcagtacctgaca
ggaaaccgtgaggttgatgtgcgcaacaatggggagcagaattacatcattcaatacgtg
gtgcctgctgttcgcggattctttgaatccatcgcgctgtcctctggcagctctttgcag
gacactctgcgcctcttggctttgtggctcacacacggtggccacattgatgtccataac
gccgtcactgaagggtttacgcgtgttagtgttgatacctggcttgaggtcataccccag
ttgatcgccagaatcaaccagcctcacaagagggtgcagcagtcagtccatgggttatta
gccgacgttggtcgtgctcacccccaggcgttggtgtatccgttgacagtcgcaagaaag
tcctggcacaacacgcgtagggtacggtcggccaaccaaattcttgaaagtatgcgtcag
cacagtctccggcttgttgagcaagcggagattgtcagtggtgagctcattcgcgtcgca
gtgctctggcacgagttgtggcacgaggccctcgaggaagcttcgcgcttgtactttggc
gaccacaacatcgagggcatgtttgccactctcgagccgcttcacgagttgctggaggct
ggcccgcaaacccttagagagatctctttcgcccagacctttggccgtgatctgagcgaa
gcgcgggattggtgccgtcagtatcaagagacgcaagactccaatgaccttaaccaggca
tgggacctgtactacacggtgttccgtcgtatcacccgccaacttccgcagatgacctcc
ctcgagttggcttactgctcgcctaatttgctaaacgccaaggatctcgaacttgctgtg
cccggaacgtaccgcagtggccaggaggttgttaggatcatgtcttttgacgccaccttc
agcgtgatcagctccaaacagcggcctcgcaagctcgatatcgttggcagcgacggcaag
acatacactttccttctcaagggacacgaagatatccgccaagatgagcgtgtcatgcag
ctgttcggtctttgcaatactttgttggccaacgactcggaatgcttcaaacgacacctc
aatattcagcgatacccggctattcccctttcacagaactctggtcttctcggctgggtc
cccaacagtgacactgtccatcagttgattcgggagtacagagattccagaaaaattctc
cttaacattgagcatcgtatcatgttgcagatggctcccgactacgacaaccttacgctt
atgcaaaaggttgaggtctttggatatgctcttgataataccactggccaagatctgtac
cgtgtcctgtggctgaagagcaagtcttctgaggcctggctggatcggagaacaaactac
acacgttctcttggtgtcatgtcgatggtcggctacatcctcggcttgggtgatcgccat
cctagcaacttgatgcttgaccgtatcacgggcaagatcatccacattgatttcggtgac
tgcttcgaagtagccatgaagcgcgagaagtatcctgagcgggtgccgttcagactgact
cgcatgctcacatatgctatggaagttagtaacatagagggtagtttccgtaccacctgt
gagcatgtgatgagggtgttgcgcgagaacaaggagagtgtcatggctgtccttgaagct
ttcattcacgatcctttgctcaactggcgcttgaccaaccccaccagcccgcctggtccc
aacttcaacgccgagcgagaggtcgccatgcccggtggccctggtccgcgcgcccgcagg
ccatcaatccttgacgctcccgtggcacccaccgagttccttgccgcgcaggctgctcct
ggtgcggatgggcatggaatggggatgtccgctaaccccggacgctcccgtgcccgcacc
aattcgtctgccatctatccgactggtagcagcatggttaatggccatggaaacaaccag
caagagcaacaggaggttcagaacgcgcgcgccctcgaggtcttggaccgtgtgcagcag
aagctcactggtcgcgacttcaagcctcatgaggagctcaatgttactgatcaggtcaac
aagctgatcatcgaggccaccaagcttgagaacctgtgccagcactacataggatggtgc
agtttctggtag

DBGET integrated database retrieval system