KEGG   Neurospora crassa: NCU05777Help
Entry
NCU05777          CDS       T01034                                 

Definition
similar to ubiquitin C-terminal hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 788 aa AA seqDB search
MSCPHIGSANLAKPSPTDNVYREDCTQCFDSIDDPAGLDVCLKCFNGGCAGDRNHAKLHA
TSRNHPLVLNIRRTRKIIERNEPPLKMSKLAIAAETESDRYDTTLTVKCLDCGIDNLNKE
DATIAPVIEAVMKANTFSRKEEVKAWEQELTTCEHILTMQQGEPRKIESQDLGHCSKCDL
NENLWLCLECGNLGCGRAQFGGVSGNSHGLAHATETKHGVAVKLGSITPEGTADVYCYNC
DEERIDDNLGAHLANWGIILAEREKTEKSLTEMQIEQNLKWEFSMTTEDGKELTPVFGPG
LTGLKNLGNSCYLASILQCLYDLPSFQQRYYSDKLGPLPSVSDPAEDLETQLRKLGDGLL
SGRYSKSDADVFASEHTPNVPYQKGLQPSMFKHLMGRGHEEFSTMRQQDAFELLQHLIKL
ITRSKHPVELGDPTQPMRFVMEQRLQCLNCKKVRYSSNEQDSVFIDVPMEKLPPEEEGQE
PKYKPVTLKQCLDSLTASEVVELTCAGCGSKDGFTKRQAFKTFPDVLVVNARKMAVVNWV
PVKIDVPVIVDDEPLNLDEYLSKGQQPDEEALPEDESAKSSAPAFVPNAEALAMLEAMGF
PRVRGEKALHATGNSDANAAMEWLFAHMDDPDIDVPLDLSASSGGAASGGAGAADPEKLA
MLESMGLSGPRAVKALNETGGDVERAIEWLFSHPDDDGADAVEEEAPAGNEGPKKEAGSS
ELPAKFQLQSIVCHKGTSIHAGHYVAFIRKKLSEDETSWVLFNDEKVVKVVDVEEMKKTA
YVYFFKRV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccccacatcgggtccgcaaacctcgcgaagccgtcgcctaccgacaatgtc
taccgcgaggattgtacccaatgcttcgattccattgacgacccagctggtctggatgtc
tgcttaaagtgctttaacggaggctgcgctggcgaccggaatcacgcaaagctccatgcc
acctcgcgaaaccacccgctcgtcctcaacattcgccgaacccgcaagatcatcgagcgc
aatgagccgcctctcaagatgtccaagctcgccatcgcggccgagaccgaaagcgatcgc
tacgatacaacacttacagtcaagtgcttggactgcggaatcgacaacttgaacaaggaa
gatgccaccatcgcccccgtcatcgaggccgtcatgaaggccaacacgttctcacgcaag
gaggaggtcaaggcctgggaacaagagctcactacctgtgagcacatcttgacaatgcag
caaggagagcctcgcaagattgagtctcaggatctgggccattgctccaagtgcgacttg
aacgaaaacctttggctgtgtttggaatgcggaaaccttggttgtggccgcgcccaattc
ggtggtgtcagcggaaactctcacggtttggctcacgcgaccgagaccaaacacggcgtc
gctgtcaagcttggttccatcacccccgagggaacggccgacgtatactgctacaactgc
gacgaagagcgcatcgatgacaacctgggcgcccacctggccaactggggcattatcctt
gccgagcgcgaaaagacggaaaagagcttgacggaaatgcagatcgagcagaacctgaaa
tgggagttttccatgaccactgaggacggcaaagagttgacacccgtttttggccctggc
ctgactggcctcaagaacctcggaaacagctgctaccttgccagtatcctacagtgtctc
tacgacttgccctctttccaacaacggtactatagcgacaagcttggtcctctccccagc
gtatcagatcctgccgaggacctcgaaacacagcttcgcaagcttggtgatggtcttctt
tccggccggtactccaagtcagacgccgatgtctttgcttctgagcacactcccaacgtc
ccttaccagaagggtctccagccttccatgttcaagcacctcatgggtcgtggccacgag
gagttctcgaccatgcggcagcaagacgcctttgagctcttgcagcatctgatcaagctc
atcactcgatccaagcatccagtagagcttggtgatcccacccagcccatgcgcttcgtc
atggagcagcgtctgcaatgcctcaactgcaagaaggtccgctacagtagcaatgagcag
gacagcgtcttcattgacgtgcccatggagaagcttccacccgaggaggagggtcaagaa
ccgaagtacaagcctgtcacgctcaagcagtgtcttgacagcctgactgcctccgaggtc
gttgagctgacctgtgcgggctgcggaagcaaggatgggtttaccaagcgtcaagccttc
aagaccttccccgatgtcctcgttgtcaatgcccgaaagatggctgttgtcaactgggtc
cccgtcaagattgatgttcccgtcattgttgatgacgagcccttgaaccttgacgaatac
ctttccaagggtcagcagcctgacgaagaagccctgcccgaggatgagtcggccaagagc
agcgctcctgcatttgtgcctaacgcggaggcgcttgccatgctcgaggccatgggattt
ccacgagtccgtggtgagaaggcgctgcatgccacaggcaactcggatgccaacgctgcc
atggagtggctgtttgctcacatggatgaccccgatattgatgtgcctttggacctcagt
gccagcagcggtggtgcggcttcaggaggcgctggcgcggctgacccggagaagttggcc
atgcttgagtcgatgggattgtctggaccgagggctgtaaaagcactgaatgagaccggt
ggtgatgtggaaagagccatcgagtggctattcagccatcctgatgatgatggtgcggac
gctgttgaagaggaggcaccggctggcaatgaggggccaaagaaggaggcgggcagtagt
gagttgccagccaagttccagttgcagtcgattgtgtgccacaagggaacgagtattcac
gctggacactatgttgctttcattcgtaagaagcttagcgaggacgagacctcctgggtc
cttttcaacgatgagaaggtggtcaaggtggtggatgttgaggagatgaagaagactgct
tatgtctacttcttcaagcgggtgtaa

DBGET integrated database retrieval system