KEGG   Neurospora crassa: NCU05924Help
Entry
NCU05924          CDS       T01034                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 329 aa AA seqDB search
MKASLMMLLAPLAAMAAPTSDNLEPRQASQSIDALMKAKGKLYFGACTDQGRLTSGKNAV
ILQNNFGQVTPENSMKWDSIQPQRGQYNFGQADYLVNWATANNKTIRGHTFLWHSQLAGW
VNNIRDKNQLTTVLQEHITTVMTRYKGKIYGYDVANEIFNEDGSLRSSIFYQVLGEDMVS
IAFKAARAADPNAKLYINDYNLDSPNYAKVTTGMIQHVNKWVAAGVPIDGIGTQGHINAG
GGSNLAAAIKALASANVKEVAVTELDIQGNNAGDYATITKGCLSEPKCVGITVWGVRDSD
SWRPNGNPLLFDANWNPKAAYNSIVQALQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccagtctcatgatgctgttggcgcctctggcggccatggcagcacccacttcc
gacaacttggagcctcgtcaagccagccagagcatcgacgctctgatgaaggccaagggc
aagctctacttcggtgcctgtaccgaccagggccgtctcacctcgggcaaaaacgcggtc
attttgcagaataacttcggccaggtcacgcctgagaacagcatgaagtgggatagcatt
caaccccaaaggggccaatataactttggtcaggccgactacctcgtcaactgggccacc
gccaacaacaagactatccgtggccataccttcctctggcactcgcagcttgccgggtgg
gtcaacaacatccgcgacaaaaaccagttgaccacggttctccaggaacacatcaccact
gtcatgacccgctacaagggcaagatctatggctatgacgtcgccaacgaaatcttcaat
gaagacggctccctccgcagcagcatcttctaccaagtcctcggcgaagacatggtctcg
attgccttcaaggcggcccgggcagctgacccgaacgccaagttgtacatcaacgactac
aacctcgacagccccaactacgccaaggtaaccacaggcatgatccagcacgtcaacaag
tgggtcgcggccggcgtgcccatcgacggtattggtactcagggccacattaatgctgga
ggcggcagcaacctcgccgccgccatcaaggcgcttgcctctgccaatgtaaaggaggtt
gcggtcacggagcttgatatccagggtaacaacgctggtgattatgctactatcaccaag
ggatgcttgagcgagcccaagtgtgtcggtattactgtttggggtgttcgtgattcggac
tcgtggagacccaatggcaacccgctccttttcgatgccaactggaaccccaaggctgcc
tacaactctattgtccaggctcttcagtga

DBGET integrated database retrieval system