KEGG   Neurospora crassa: NCU05984Help
Entry
NCU05984          CDS       T01034                                 

Definition
similar to formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ncr  Neurospora crassa
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ncr03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 415 aa AA seqDB search
MPEIAEIARAVHFLRLHFVGKVIKHAEAIDDGNVFGKVGTDGPKMAAGLIGKKMVSAGTQ
GKYFWMELSKAPHLVMHFGMTGWIHIKGERTAYTNYYKKMKPDELDKWPPKYWKFKIETE
DGDEMAFTDPRRFGRVRVVDCPGKDIRKYSPLVENGPDPVVDLDVFTEDYLREKMKSRRV
PIKALLLDQAVISGIGNWVADEVLYHAKLHPEQYCNDFSDAEMKQLYESIRYVCQTAVDK
LGDSDQFPDDWLFNYRWGKGSKNAHSHTPNGDKLAFLTVGGRTSCYAPARQKKTGQIVSG
VKEEPLESAEEKDSSKKAPGTKGAKSKNKSEELEADGSKVKAEMAVSRKRKIKIEEDGEV
NFTPHNAKAHPSKKPTRSQYFEDAKKPNGDAGQTEEAKTDISGRRRSGRLQSKAA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaatcgcggagattgcgcgtgctgtccactttctgcgcctgcactttgtaggc
aaggtcatcaagcatgcagaagccattgatgacggcaatgtgtttggaaaggtcggtaca
gatggaccaaagatggcggctggccttatcggcaagaagatggtatcagcaggaactcaa
ggcaaatatttttggatggaattgagtaaggctcctcatcttgtaatgcactttgggatg
accggctggatccatatcaagggcgagaggacagcatacacgaactactacaagaagatg
aagcctgacgaacttgacaaatggccgcccaagtattggaagttcaagatcgagacagaa
gatggcgatgagatggcgtttaccgatccgcggcgctttggccgtgtccgtgttgtggac
tgccctggaaaggatattcggaagtactcacctttggtggaaaacggcccagatccggtg
gtcgacctcgatgtgttcaccgaggattacttgcgggagaagatgaagtcgcgccgcgtg
cccatcaaggctcttttgcttgatcaggctgttattagtggcattggaaattgggtcgct
gatgaagtattgtatcacgcaaagcttcacccggaacagtactgcaacgacttcagcgat
gctgagatgaagcagctttacgagtccatccgatatgtgtgccagacggctgtcgacaag
cttggcgattccgatcagttcccagacgactggctcttcaactatcgctggggtaaaggc
tccaagaatgcacacagtcacactcctaacggcgacaagttggcctttctcactgtcggc
gggcgcacgagttgctatgcacccgccaggcaaaagaaaaccggccagattgtgtccggc
gtgaaagaagaaccccttgagtcggctgaagagaaagactcctcgaagaaggcaccggga
acgaagggggccaaatcaaagaacaaaagtgaggagctagaagccgatgggtcaaaggtg
aaggcggaaatggccgtctcaaggaagcggaagatcaagatagaagaagatggcgaggtg
aattttacgccacacaacgcaaaggcacatccctcaaagaagcctacgcgctcgcaatac
tttgaagacgccaaaaagccgaatggggacgcagggcaaacagaagaagccaagactgac
atctcaggaagaagacgctctggaaggttgcaaagtaaagcagcttga

DBGET integrated database retrieval system