KEGG   Neurospora crassa: NCU06005Help
Entry
NCU06005          CDS       T01034                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ncr  Neurospora crassa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NCU06005
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NCU06005
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCU06005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI
AA seq 566 aa AA seqDB search
MSPSMWTMRWSHQVINEHHRHHLKSCSTISRVNNALKSIIQRTRPGDTNTDTPHEALPST
PLEPVPTRTTSVTMKLLNLNDGVEAGVMCVEPTLTNDGMDARNLAKAHKGFSKNDIRSIG
ITNQRETTLVWDHETGEPLYNAVVWSDTRTKSLVRDLKDKDGADAIKDLCGLPLSTYPSS
VKLLWLIENVEAVKQAYEEGRLAFGTVDTWLIYKLNGGAQAESPVHVTDSTNASRTMFMN
IRTLQYDDKMLGFFGIDRTKVHLPKIVPSSDPECFGRIASGALSGVPIAGCLGDQSSALV
GQCGFNPGQAKNTYGTGCFLLYNVGTEPVISQYGLLSTVAYDFGQGRAPVYALEGSIAVA
GAGVTFLQNNLNFIENAKQINDLAESVPDNGGVVFVTAFSGLFAPYWIDDAKGTLFGITQ
HTQKGHIARATLEATCFQTKAILDAMEKDSGCKLKLLAVDGGLSNSDLTMQTQADISGIP
VDRPAMCETTALGAAIAAGLATGVWSDTTELQEVNRTGRKVFEPKISRKCAEKRFKKWNQ
AVQMSRGWLQDNDNEDDECDEEVKKA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctcgatgtggacgatgaggtggtcgcaccaggtcatcaatgaacaccatcga
caccacttgaagtcttgttcgaccatcagccgtgtaaacaacgctctcaagtccatcatc
caacgaacaagacccggagacacaaacacagacaccccgcacgaggcattaccatctacc
ccgcttgagcccgttcctacaagaacaacttcagtcaccatgaagttactcaaccttaac
gacggcgtcgaggccggcgtcatgtgtgtagaacccaccctcacaaacgatggcatggac
gcccgcaacctagcaaaggcccacaagggcttctccaagaacgacatccgctccatcggc
atcaccaaccagcgcgaaaccacgctcgtgtgggaccatgaaaccggcgagcctctctat
aatgccgtcgtctggtccgatacccgcaccaagtcccttgtccgcgacctcaaggacaag
gacggcgccgatgccatcaaggacctttgcggtcttcccctctccacttatcccagcagc
gtcaagcttctttggctcattgagaatgttgaggccgtcaagcaggcctacgaagaaggc
cgtcttgccttcggcactgtcgacacttggctcatctacaagctcaatggcggtgcccag
gctgagagtcctgtccacgtaacagacagcaccaacgccagcagaaccatgttcatgaac
attcgcactctgcagtatgacgacaagatgctaggattcttcggaattgaccgaaccaag
gtgcatttgcccaagatcgtcccttcgtcggaccctgaatgtttcggtcgcattgccagt
ggtgcgctgtcgggtgtgccgatcgctggttgcttgggcgatcaatccagcgccctggtt
ggccagtgcggcttcaaccccggccaagcaaagaacacctacggcactggctgcttcctg
ctctacaacgtcggcaccgagcccgtcatctcgcagtacggtcttctgtccactgtcgcc
tacgactttggccagggccgcgcgcccgtctacgccctcgaaggcagcattgctgtcgcc
ggcgccggcgtcaccttcctccagaacaacctcaacttcattgagaacgctaagcaaatc
aacgaccttgccgagtcggtgcccgacaacggaggtgttgtgtttgtcaccgccttcagc
ggcctgttcgccccttactggatcgatgatgcaaagggaactttgttcggaattactcaa
cacacccaaaagggacacattgctcgtgccactctcgaggctacttgcttccagaccaag
gctatccttgatgccatggagaaagactcgggctgcaagctcaagctcctcgctgtcgat
ggtggtctctccaactccgacctgaccatgcagacccaggctgacatcagcggtattccc
gttgatcgcccggccatgtgcgaaaccaccgctcttggcgctgccattgcggccggcctc
gctaccggtgtctggagcgataccaccgagctccaggaagttaaccggaccggccggaag
gtctttgagcctaagatttctcgcaagtgtgccgagaagaggttcaagaagtggaaccag
gctgttcagatgagccgcggctggctgcaagacaatgacaacgaagacgacgagtgcgac
gaggaggtgaagaaggcctaa

DBGET integrated database retrieval system