KEGG   Neurospora crassa: NCU06240Help
Entry
NCU06240          CDS       T01034                                 

Gene name
pkac-1
Definition
(RefSeq) protein kinase A catalytic subunit-1
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ncr  Neurospora crassa
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NCU06240 (pkac-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NCU06240 (pkac-1)
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   NCU06240 (pkac-1)
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NCU06240 (pkac-1)
Chromosome [BR:ncr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    NCU06240 (pkac-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group III; III
AA seq 536 aa AA seqDB search
MPLPSLGFLKKKRTKEGNTDPSSTSHPTSPVTPTSASSLDRNSIQSSIARISSHSSASQA
TSQSVATGTTTIDTTHMPTLLPHENPVNMNSVPVQQHAYPPQHTPSPGVAEQQNLPSISN
LIHQPQYDQPATYKQSSRYVPSVSPANGGLPAPHTPQPSMPQPQQATLQPPHNHHQQSQA
QQQQQQQQQQQPQQQQQQQQQQQQQLQPQPSQPRATKGKYSLADFEILRTLGTGSFGRVH
LVQSRHNSRFYAVKVLKKAQVVKMKQVEHTNDERRMLAEVKHPFLITLWGTFQDAKNLYM
VMDFVEGGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHSRDIIYRDLKPENLLLDRHG
HLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPF
WDGSSPMKIYENILKGKVRYPQWVNPDAQDLLERLITADLSKRLGNLYGGPQDVKSHPWF
AEVTWDRLARKDIDAPYTPPVKAGAGDASQFDRYPEETERYGQGGPDEYGHLFPDF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcctagcctcggtttcctcaaaaagaaacggacgaaggagggcaatacggac
ccttcttcgactagccacccaaccagcccagtcacccctacctcggcctcgagcctcgac
cgcaactccatccagagcagcatcgcccggatctcgtcgcactcgagtgcgtcgcaggcc
acttcccagtcagtcgcgaccggcactaccaccatcgatacaacccatatgcccactctt
ctgccgcacgaaaaccccgtcaacatgaattctgtcccggtccaacagcatgcctacccc
cctcagcacacgccttctcctggagtagcggagcagcagaacctcccgtccatctccaac
ctcatacaccaaccgcaatacgaccaacctgccacctacaaacagtcgtctagatacgtt
ccatctgtatccccagctaacggcggcctgcccgcgccgcacacgccccagccgtccatg
cctcaaccacagcaagcaacactgcagccgccgcataatcaccatcagcagtctcaagct
cagcagcagcagcagcagcagcagcagcaacaaccccaacagcagcagcagcaacaacag
caacagcaacagcaactgcagcctcagcctagtcagcccagggccaccaagggcaagtat
tcgctcgccgacttcgagatattgagaaccctcggcactggtagcttcggcagagtccac
ctggtccagtctcggcataactcgcgcttctatgccgtcaaggtgctgaagaaggcccaa
gtggtcaagatgaagcaggtcgagcacaccaatgacgaaagaagaatgctagcggaggtc
aaacaccccttcctgatcacgctatggggaacatttcaggatgccaagaatctttacatg
gtgatggatttcgtagagggcggcgagctcttctcgttgctgaggaagtccggacgcttt
cctaaccccgttgccaagttctacgctgcagaagtcaccttggccctggagtacctgcac
tcgcgggatatcatttacagagatctgaagcccgagaacctgcttcttgaccgccacggc
cacctcaaaattacggatttcgggttcgccaagcgggttccagataagacgtggacactg
tgtggtactccagactacttggcaccagaggttgtttccaacaagggttacaacaagtcg
gtagattggtggtccctgggtattttgatttacgaaatgctttgcggttacacgcccttc
tgggacggcagctcccccatgaagatctacgaaaacattctcaagggcaaggtcagatac
cctcagtgggtcaaccccgacgcgcaggacttgttggagcggttgatcacggcagacctg
agcaagcgccttggaaacctgtacggcggaccgcaagacgtcaagtcacacccttggttt
gccgaggtgacttgggaccgactggcaaggaaagatatcgacgcgccgtatactccgcca
gtcaaggccggagcaggagacgcgagccagttcgacaggtatcctgaggagactgagcgg
tatggacaaggagggccagatgagtacggtcacttgttcccggacttctaa

DBGET integrated database retrieval system