KEGG   Neurospora crassa: NCU06300Help
Entry
NCU06300          CDS       T01034                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ncr  Neurospora crassa
Pathway
ncr00230  Purine metabolism
ncr01100  Metabolic pathways
Module
ncr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCU06300
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NCU06300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 RsgA_GTPase MMR_HSR1 AAA_22 ABC_tran AAA_14 AAA_28 AAA_29
Motif
Other DBs
NCBI-GeneID: 3878737
NCBI-ProteinID: XP_962562
UniProt: Q7SAD0
Position
Linkage Group IV; IV
AA seq 215 aa AA seqDB search
MSAMRPVRLVNSILRTRLIHTMAPTLPPDRRPVVISGPSGVGKGTLFKLLFERHPDTFTL
SVSHTTRGPRPGEKDGVDYHYVTKEAFEELKAKGGFVESAQFGSNFYGTSKATIEEQSAK
GKVVVLDIEMEGVKQIQASGFPARYVFIAPPSEEELEKRLRGRGTDKEEDILKRLAQAKN
ELAFSKTGVHDKIIVNEDLETAYKELEEFVYAPVA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatgcgcccagtccgtcttgtcaactccattcttcgaacgcgtctcatccac
acaatggctcccactctccctcctgatcgtcgccccgtcgttatctccggcccctctggc
gtcggcaagggcaccctcttcaagctcctcttcgagagacaccccgacacttttactctt
tccgtgtcgcataccacccgcggccctagacccggcgagaaggatggcgtcgactaccac
tatgtcaccaaggaagctttcgaggagctgaaggccaagggcggtttcgtcgagagtgcg
cagttcggcagcaacttctacggaaccagcaaggccaccatcgaggaacagtccgccaag
ggcaaggttgtcgttctcgacatcgagatggagggtgtcaagcagatccaggcctctggc
ttccccgcccgctacgtctttatcgctcccccatcagaggaggagctggaaaagagactc
cgcggccgcggtactgataaggaggaggatattctcaagagactggctcaggccaagaac
gagctcgctttcagcaagaccggtgtccatgacaagatcatcgtcaacgaggatctcgag
acggcttacaaggagctcgaggagttcgtctatgcgccggttgcctga

DBGET integrated database retrieval system