KEGG   Neurospora crassa: NCU06344Help
Entry
NCU06344          CDS       T01034                                 

Definition
similar to disulfide isomerase
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ncr  Neurospora crassa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCU06344
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCU06344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 813 aa AA seqDB search
MRWLPLFLGAARLAVAASTTTETETEDEVKVYTKFNDVPVPPLIELTPDNWEKESKASKW
LMVKHYSPYCPHCIDFAPTYQTLYEFYYTSKPVGDENANFTTFYDFRFGTINCVAYYDLC
SAHKASSYPTTTLYKNGEQVAALKGVKSMPVLSEIVEKALEATKPGSRPAKLELPKPGEI
VAPGYVPKVAAPQDTKETSNVDIAKDVPKVDLVKDSATVEQPVKDTFITGNDEYLMPTPK
TEDKATEKVVDKVVDKAADKATETKATETKAVESKAASKADPSTEATAKIEKAKGKEEEE
KKKSTSPAYYEAPAVAAAAAASIKGNKPKTTPNPNGISQPLTAESFQSQVTMTQEPWFIK
FYAPWCHHCQAMAANWAQVAREMKGRLNIGEVNCEQEARLCKDVRVTGYPTIQFFRGGER
VEYTGLRGLGDFLAYAEKAIDISKGVQDVDAASFKALEEKEEVIFVYFYDHATTTEDFLA
LERLPLSLIGRAKLVKTRDPELYDRFKITTWPRLLVSREGRPTYYQPLTPNEMRGTRQVL
NWMKSVWLPIVPEMTASNAREIMDGKIVVLGLLNRDDEESFNGAIREMKSAASEWMDKQI
QLFQLERQELRNAKQLRIEEAEDRNDQRALRNAKNIRINMDRADRKEITFAWVDGVFWQR
WIRTTYGIDVKDTGDRIIINDEDNRRYWDQTTTGNPIVPSRTSILETITKISQNPLNIKP
KLTISAFEKLFFDIRMTFSEHPYLSMGCILGIAFGCLSWFRNSARAQRRAGHGTHFKLEE
GGIGAPSEKGSTGGFIQSVFGGSGGSSNGPKAD
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggcttcccctattcctgggcgcggcccgtctggccgttgccgcatcaacaacg
acagaaacagaaacagaggacgaagtgaaagtgtacaccaagttcaacgatgtaccggta
ccaccactcatcgaactcacccccgacaactgggagaaggaatccaaagccagcaaatgg
ctgatggttaagcactacagcccttactgccctcactgcattgactttgctcctacatac
caaacattatacgagttctactacacatcgaagcccgtcggggacgagaacgcgaatttt
accaccttctacgacttccgcttcggcaccatcaactgcgtagcgtactacgatctctgc
agcgcacacaaggcatcttcctacccaactaccaccctctacaagaatggcgaacaggtt
gcggctctcaagggcgtcaagtccatgcctgttctgagtgagatagttgagaaggccttg
gaagcgaccaagcccggatcaagacccgcgaagctcgagcttcctaagcccggcgaaata
gttgctcccggctacgttcccaaggtcgccgccccccaagataccaaggaaacatccaac
gttgatatcgccaaggatgtgcccaaggtcgatcttgtcaaggactctgccacggtcgaa
caacctgttaaagataccttcatcaccggaaatgacgagtacttgatgcccactcccaag
accgaggataaggccacggaaaaggttgtggataaggttgtggataaggcggcggacaaa
gccacggaaaccaaggcaacggaaactaaggccgtagagtctaaggccgcctctaaggcc
gacccttctaccgaggccacggccaagatcgagaaggccaagggcaaggaggaagaggag
aagaagaagtctacgtctcctgcttactacgaggcccccgctgttgctgccgctgccgcc
gcgtctatcaagggcaacaagcccaagactactcctaaccccaatggcatctcccagccc
ctgactgccgagagcttccagagccaggtcaccatgacccaggagccttggttcatcaag
ttttacgccccttggtgccatcactgccaagccatggccgccaactgggctcaggttgct
cgcgagatgaagggccgcctcaacattggcgaggtcaactgcgagcaggaggcccgtctc
tgcaaggacgtccgtgtcaccggttaccccaccatccagttcttccggggaggcgagcgt
gtcgagtacactggcctccgtggtctcggtgactttctcgcgtatgctgagaaggccatt
gacatctctaaaggtgtacaggacgtcgatgccgcttccttcaaggctcttgaggagaag
gaggaggtcatctttgtttacttctacgatcatgccaccaccaccgaggactttctcgcc
cttgagcgtcttcctctcagccttatcggccgtgccaagctcgttaagacccgcgacccc
gaactgtacgatcgcttcaagattaccacctggccccgcctgctcgtctctcgcgaaggc
cgccccacctactatcagcccctcacgcccaatgagatgcgcggcactcgccaggttctt
aactggatgaagtccgtttggctacccattgttcccgagatgaccgcctccaacgcccgc
gagatcatggatggcaagattgttgtcctcggactccttaacagagacgacgaagagtcc
ttcaacggtgccatccgcgagatgaagtcggccgccagcgagtggatggacaagcagatt
cagctcttccagctggaaaggcaggagcttcgtaatgctaaacagctgcgcatcgaggag
gctgaggaccgcaatgaccagcgtgctttgcgcaacgccaagaacatccgcatcaacatg
gacagggcagacaggaaggagatcacctttgcttgggttgatggcgttttctggcagaga
tggatcaggaccacctacggtattgatgtcaaggacactggtgaccggatcatcatcaac
gacgaggataaccgtcgctactgggatcaaacaaccaccggcaaccctatcgttcccagc
cgcacgtccatcctcgagaccatcaccaagatctcccagaatcctctcaacatcaagccc
aagctcaccatctccgccttcgagaagcttttcttcgacattcgtatgaccttctcggag
catccttacctttccatgggctgcattctcggcatcgccttcggttgcctctcgtggttc
cgcaacagcgctcgcgctcagaggagggccggtcacggtacgcacttcaagctggaggag
ggcggcattggtgctcccagcgagaagggcagcaccggcggcttcattcagagcgtattt
ggcggcagcggtggaagcagcaatggacccaaggctgattga

DBGET integrated database retrieval system