KEGG   Neurospora crassa: NCU06372Help
Entry
NCU06372          CDS       T01034                                 

Definition
similar to ubiquitin C-terminal hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 253 aa AA seqDB search
MASNEVDPHGGVPAASDRPAFIPLEANPELMTSLLHKLGLSTSLQVHDVYSLTDPDMLAF
IPRPALALLMVFPVSAAYESARLAEDSLLEDYSGKGPLEPVLWFRQTIRNACGLMGLLHA
AINGPARQLVEEGSTLDKIIKDATPLDPVARARVLETNSELANAHKSAATQGDTEAPAAT
DEVDLHYVCFVKTEDGGLWELDGRRKGPLKRGELGKDDDVLSQAALTLGPLKFLERGGGD
LRFSCVALASSFD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaatgaagttgatccccacggcggcgtccctgctgcttccgatcgtccggcc
ttcatccccctcgaagccaaccccgaactcatgaccagcctcctccataagctcggtctc
tcgacctccctccaggttcacgacgtctactctctcaccgacccagacatgctcgccttc
atcccgcgccctgccttggccctgctgatggtcttccccgtctcggccgcctacgaatcg
gctcgcctcgctgaggactctctcctcgaagactactcaggcaagggtcccctagagcct
gttctctggtttcgccagacaatccgcaacgcctgcggtctgatgggtctgcttcatgcg
gccatcaacgggccggcccgccagcttgtggaagagggctcgactttggacaaaatcatc
aaggatgcgacaccgctggatcccgttgcgagggcaagagtgctggaaacgaactctgag
ctggctaatgcccacaagagcgcggcgacccagggcgataccgaagcaccggccgctaca
gacgaggtcgatctgcactatgtctgcttcgtcaagaccgaggatggaggcttgtgggag
ctagacggacgcagaaagggaccgctgaagaggggtgaacttggcaaggacgatgatgtc
ctgagccaagcggcgttgacgcttggaccgctcaagttcctagagagagggggcggcgat
ttgaggttcagctgtgtggcacttgccagcagcttcgattag

DBGET integrated database retrieval system