KEGG   Neurospora crassa: NCU06419Help
Entry
NCU06419          CDS       T01034                                 

Gene name
mek-1
Definition
(RefSeq) MAPK/ERK kinase
  KO
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCU06419 (mek-1)
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    NCU06419 (mek-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NCU06419 (mek-1)
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NCU06419 (mek-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group III; III
AA seq 518 aa AA seqDB search
MADHQGQSSNDAAPKANPGLQAPQLQQGPSPVPTMAPAPAPLLRPAIPGARPGGRGPPRL
GLAIPPSLSVKPVGNPGAPPARAAPPQLKLATPMGSTTIPHEQPAGRPGAQGYSASGASD
SSAAHSRSGSFGPESNPTSADTRYSNVSFIGAQRPHGTPDPVSAVGSLYSNASEGGVGME
RENSLHGLEAFDKLTLEKARTLDVEELDDDGWRIAMMEKRVEELGPLGEGAGGAVTKAKL
KGGKTVFALKIITANPDKDVAKQIVRELGFNKQCASEHICRYFGAVVDTQSATISIAMEY
CEGGSLDSVYKEVKKLGGRTGERVLGKIAEGVLHGLTYLHSKKIIHRDIKPSNILLCRNG
EVKLCDFGVSGDYGTNGAANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRF
PFPADGTDSQPRAGLIDLLTYIVRQPVPKLKDEPDANIFWTDKFKYFIDCCLEKDPNRRA
SPWRMLDHPWMLEIRSRRVNVARFLATVWGWEDGKEEA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaccaaggtcaaagcagcaacgatgctgcccccaaggccaacccaggtctc
caggcaccccaactccaacagggaccatcccccgttcccacaatggcaccagcccccgca
cccctcctccggccagccatccccggcgctcgccccggtggtcggggccccccacgtctt
ggccttgcgatccccccgtctctaagtgtcaagcccgttggtaatcccggcgctcctccg
gcgcgtgcggcgccaccacaactcaaactcgctacccccatgggtagcaccacaatacca
catgagcagcctgccggacgaccaggcgcccaaggctatagcgctagcggtgccagcgat
agcagtgcggcgcatagcaggagtggcagctttggtcccgagagcaaccctaccagcgcc
gacacccggtatagtaatgtttcgtttatcggcgcccaaaggccacacggcacaccagac
cctgtctctgcagtgggttctctctactccaatgccagcgagggaggtgtgggtatggaa
cgagaaaacagcctgcatggattggaagcattcgacaagcttacactggagaaagcgagg
acattagatgtcgaagagcttgatgacgatggatggaggatcgccatgatggagaagaga
gtcgaggagttgggacccctaggtgagggtgcaggaggtgcggtaaccaaagccaagttg
aagggcggcaagaccgtatttgcgctcaagatcatcacagcgaaccccgacaaggacgtt
gccaagcaaattgtccgtgaattagggttcaacaagcagtgcgcctccgagcacatctgt
cggtactttggtgccgtcgtcgacacccagtccgcgaccatctccattgccatggagtat
tgcgaaggcggttctcttgacagtgtttacaaggaggtcaagaagcttggggggcgtaca
ggagaaagggtattgggcaagattgccgagggcgttctacacggattgacatatctgcat
agcaagaagatcatccaccgtgacattaagcctagcaacatccttctctgtcgcaacggc
gaggtcaagctttgcgatttcggtgtctcgggcgattatggcacgaacggcgcggccaac
acattcatcggtaccagttattacatggcgcctgagcgaatcacaggccagtcatatacc
atcacctcggacgtttggtctttgggtgttaccctgctcgaggttgcacagcaccgcttc
cccttccccgccgatggtaccgactcacaaccccgtgccggtctcattgacctgttgacg
tacatcgtccgtcagcctgtgccgaagctgaaggatgagcctgatgcgaacattttctgg
actgacaagttcaagtacttcattgactgctgcttggagaaggatcccaaccgcagagcg
agcccttggcgtatgctcgaccacccctggatgttggaaatacggtcaaggcgtgtgaac
gtggcccgtttcctggccacggtatggggctgggaggatggaaaggaagaggcatag

DBGET integrated database retrieval system