KEGG   Neurospora crassa: NCU06448Help
Entry
NCU06448          CDS       T01034                                 

Definition
enoyl-CoA hydratase, mitochondrial precursor
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ncr  Neurospora crassa
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU06448
   01212 Fatty acid metabolism
    NCU06448
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NCU06448
   00650 Butanoate metabolism
    NCU06448
  Lipid metabolism
   00062 Fatty acid elongation
    NCU06448
   00071 Fatty acid degradation
    NCU06448
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCU06448
   00310 Lysine degradation
    NCU06448
   00380 Tryptophan metabolism
    NCU06448
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCU06448
Enzymes [BR:ncr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCU06448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 299 aa AA seqDB search
MRSVAFNNTLRGLSRAGSRFQPTTLPRIAAARAYSTPAESQYEFIQVSEPRPGVGQVTLN
RPKALNALSTPLITELNAALLSFQQSPTIRAIVLTGSERAFAAGADIKEMAPLTFSKAFL
DSFIESWSNLTFTVKKPIIGAVSGHALGGGCELALMTDIIYCTKTANFGQPEIKLGTIPG
AGGSQRLTRAVGKSKAMELILTGKSFSGEEAERWGVAARAFDSYEELMEGALKTAETIAG
YSKVAVQAAKEVVNKSQEVGLRDGVEYERRMFHALFGSQDQKIGMKAFAEKGKAKWVDE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcagttgccttcaacaacaccctccggggtctatcccgggccggctcccgcttc
cagcccactacccttccccgtattgcggctgcccgtgcctattctactcctgccgagagc
cagtatgagttcatccaggtctccgagccccgtcccggtgtcggtcaagtaaccctcaac
cgccccaaagccctcaacgccctctccaccccgctcatcaccgaactcaacgccgccctc
ctctccttccagcaatcccccaccatccgcgccatcgtcctcaccggctccgagcgcgcc
ttcgccgccggcgccgacatcaaggagatggcccccttgaccttctccaaggccttcctc
gactccttcatcgagtcctggtccaacctgaccttcaccgtcaagaagcccatcatcggc
gccgtctccggccacgccctcggcggcggctgcgaactggcgctgatgacggacatcatc
tactgcaccaagacagccaactttggccaacccgagatcaagctgggcacgatccccggc
gcgggcgggtcccagcggctgacgagggcggtggggaagagcaaggctatggagctgatc
ctcacgggaaagagcttcagtggtgaggaggcggagaggtggggggttgcggcgagggcg
tttgacagctatgaggagttgatggagggggcgctcaagacggcagagacgattgcggga
tatagcaaggtggcggtgcaggcggccaaggaggtggttaacaagagccaggaggttgga
ctgagggatggcgtggagtatgagaggcgcatgttccatgccttgtttggaagccaggat
cagaagattggaatgaaggcttttgcggagaagggcaaggccaagtgggttgatgagtaa

DBGET integrated database retrieval system