KEGG   Neurospora crassa: NCU06472Help
Entry
NCU06472          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCU06472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 508 aa AA seqDB search
MSGDDDWWTSSNEALLVSLVTPSDTGVKTLDTFHPEYTNNIFGEKEQIFGYKGLRINLQY
NASDMLPNLKVSYKKKYQPTADEEALDINEVLSEFLPEIAFQKQSDFETRLKSIPDNWTP
PGTLVTSFTNKDGEYEVYSGKITDPAVKQLLNRIQILVPFFVDGGTPIDMEDPDVDRWTI
YFLYNKRPLLNQPDKFSYHFAGYSTLYRYYAFQPPAESESKTPTDTPTFSVDGDFDLDTL
PCRTRISQFIIIPPFQQKGLGSRLYSIIYQQYLKHEPTIELTVEDPNEAFDDMRDLADLA
FLSKQPEFQALKIDTSVEIPEEGKAPSNIVDQAAWEACRKKFKIVPRQFARVLEMYLMSQ
LPESVRPGLGAPEDEDYEEQSGRSKSKGHEKALPKPTPEDEHTYRLWMMLVKRRLYVHNR
DALGQLELKERREELAKVFAGVEFDYARLLIKAEEQGKLAQADGETAGDQVPATPSAANG
KRKLDEVEQAEGTAAASSKKAKVESGHA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagacgatgactggtggacgtcttccaacgaggccctcctggtctcgctcgtc
accccctccgacactggcgtgaaaacactggacacgttccacccagaatacacaaacaac
atctttggcgaaaaagaacaaatctttggctacaagggtctgcgcattaatctgcagtac
aatgccagtgacatgctgcccaacctcaaggtgtcctacaagaaaaagtaccagcccaca
gccgacgaagaggccctcgacatcaacgaggtcctgtccgagttcctccccgaaatcgcc
ttccagaagcaatccgacttcgaaacccggctcaagtccattcccgacaactggaccccg
cccggaactctcgtcacaagcttcaccaacaaagatggggaatacgaagtgtacagcggc
aagatcacagaccctgccgtcaaacagctcctcaaccgcatccagattctcgttcccttc
tttgtcgacggaggcacccctatcgacatggaagatcccgacgtcgaccgatggacaatc
tatttcctctacaacaagcgtcctcttctcaaccaacccgacaaattctcctaccatttc
gctggctacagtaccctctaccgatactatgccttccaaccacccgccgagtccgaatcc
aagaccccgaccgataccccgaccttctccgtcgacggcgacttcgacctcgacactctc
ccctgccgcacccgcatctcccagttcatcatcattccgcccttccagcaaaagggcctc
ggctcgcgcctctacagtattatttatcagcaatatcttaagcacgagcctaccattgag
ttgacggtggaagaccccaacgaggccttcgatgacatgcgcgatctcgccgacctcgca
ttcctcagcaaacaacccgagttccaagcgctcaagatcgacaccagcgtcgagattccc
gaggagggcaaagcacccagcaatattgtcgaccaagcagcctgggaagcctgccgaaag
aagttcaagatcgtgcctcggcagtttgcccgcgtgctcgagatgtacctgatgtcccag
ctccccgagagcgtccggccaggactgggcgctcccgaggatgaggactacgaggagcag
agcggcagaagcaagagcaagggccatgaaaaggccctgccaaagcccacccccgaagac
gagcatacgtataggttatggatgatgctcgtcaagcggaggctatacgtgcacaacagg
gacgcgctgggccagctggagcttaaggagcgcagggaggagctggccaaggtttttgct
ggtgtggagtttgattatgctcggttgctgatcaaggctgaggagcagggcaagctggct
caggctgatggtgagactgccggtgatcaagtgccggctactccttctgctgctaatggt
aagcgcaagttggacgaggttgagcaggcggagggaacagctgctgcgtcgagcaaaaag
gccaaggtcgagagcggacatgcatag

DBGET integrated database retrieval system