KEGG   Neurospora crassa: NCU06518Help
Entry
NCU06518          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ncr  Neurospora crassa
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ncr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 326 aa AA seqDB search
MPPYNPFKINPNFLRPPFKASVMSTQVAVAAGVAGLGIYAFYLRRNASGSATGTALATNM
DASDLKPGKLPLSGFGFHSLRLHSTELINHNTKKLRFELPDRSQPSGMGLTSALLTISFP
KGRWLPVIRPYTPTNDLNEPGFVELMVKLYPGGKQSTHLHSLQPGDTLTVAPIPELKWTL
NKHPHVAMIAGGAGITPMYQLVRGILTNPADKTRITLVWGVNTDEDIFLRDQLAELEQNY
PGRLKTVYVVAQPAAQSPHQKGFVTRQVLEQAGLNGATEKSKGTKVLLCGPPAMEKALKG
TKGWVGGGKKGVLQELGYTQDQIYNF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctacaatccattcaagattaacccgaacttcctccgccctcccttcaaggct
agtgtaatgagtactcaagttgccgtcgcggctggtgttgctggcctgggaatctacgcc
ttctacctgagacggaacgcaagcgggagcgcaacgggaactgctttagccacaaacatg
gacgccagcgatctcaagccgggcaagctgcctctgtccggctttggcttccacagcttg
cgcctgcacagtaccgagctcatcaaccacaataccaagaaattgcgtttcgaacttcct
gaccgctctcagcccagcggtatgggcctcacctctgctcttctgaccatctccttcccc
aagggacgatggctccctgttatccgcccatacacccctacaaatgacctaaacgaaccc
ggcttcgttgagctcatggtcaagctctaccccggcggcaagcaaagcactcacctgcac
tcgctccagcctggcgacaccctaaccgtagcccccattcccgagctcaagtggactctc
aacaagcacccgcacgtggccatgatcgccggcggcgccggcatcacccccatgtaccag
ctcgtccgcggtatcctgaccaacccggccgacaagacccgtatcaccctcgtctggggc
gtcaacacggacgaggacatttttctgcgtgaccagctcgccgagcttgagcagaactac
cctggccgcttgaagactgtttacgtcgttgctcaacctgcagcacagtccccgcatcag
aaggggtttgtgactaggcaggtgctggaacaggccgggctcaatggtgcgacggagaag
agcaaggggaccaaggtgttgctttgtggaccgccggccatggagaaggcgttgaaggga
acgaagggatgggtaggaggtggcaagaagggggtgttgcaggagttggggtatacccag
gatcagatttacaacttttag

DBGET integrated database retrieval system