KEGG   Neurospora crassa: NCU06530Help
Entry
NCU06530          CDS       T01034                                 

Definition
similar to palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ncr  Neurospora crassa
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ncr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ncr00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 330 aa AA seqDB search
MAISKQLKLLLTSGSLIAAALASPVQKPLNDDDIDDTPLPLVIWHGLGDSYSAAGLREVG
ALADAINPGTLVYFIRMDDDGSRDRSATFLGNVTEQVAKACADIAAHPILSTAPAIDALG
FSQGGQFLRGYIERCNNPPVRNLVTFGSQHNGISAFRDCPWSDWVCRGAMALLKGNAWTQ
FVQSRLVPAQYYRNLDEYEQYLEHSNFLADINNERMFKNRTYRENLAKLENLVLYMFEDD
TTVVPKETAWFEEVNGTEITPLRARKMYSEDWIGLRELDRKGGLHFRTAPGDHMQLTDQL
LNETFAEFFGPIKKAKKSAPRPLMLGGGDL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccaagcagctgaagctgttgcttaccagcggctcgcttatcgcagccgcg
ctggccagtcccgtacagaagccactcaacgacgacgacatcgacgacacaccactgcct
ctcgtcatctggcatggcctaggagacagctactcggccgcgggcctccgcgaagtcggc
gcccttgccgacgccatcaaccccggcacgctcgtctactttatccgtatggacgatgac
ggcagccgcgatcgttccgccaccttcctcggcaacgtgaccgagcaagttgccaaagcc
tgtgccgacatcgccgcgcacccgatcctttctacagcgcccgccatcgacgccctcggc
ttcagccaaggcggccagtttctgcgggggtacatcgagcgttgcaacaatccacccgtc
cgcaaccttgttacttttggctcccaacacaacggcatcagcgccttccgcgactgcccc
tggtccgactgggtttgccgcggcgccatggcgctgctcaagggtaacgcctggacgcag
tttgtccagagccggctcgtacccgcgcagtactatcgtaacctggacgagtacgagcaa
tatcttgagcactccaatttcctagcggacatcaacaatgagcggatgttcaagaaccgg
acctacagggagaacctggccaagctggagaatctggtactgtacatgtttgaggacgac
acgacggtggtacccaaggagacagcttggtttgaagaggttaatggcaccgagatcacg
cccctccgtgcgaggaagatgtactcggaggactggatcgggctgcgtgagttggatcgc
aaaggcggattgcacttccgcacggcgccgggcgatcatatgcagcttacggaccagttg
ctgaatgagacgtttgccgagttctttgggccgataaagaaggccaagaagagtgctccg
aggccgcttatgcttgggggcggtgacctctga

DBGET integrated database retrieval system