KEGG   Neurospora crassa: NCU06558Help
Entry
NCU06558          CDS       T01034                                 

Definition
D-amino-acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ncr  Neurospora crassa
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ncr00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ncr00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:ncr00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ncr04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 362 aa AA seqDB search
MSTIVVVGAGVSGLTCALQLAKQGGNTITVVAKHMPGDYDPEYTSPFAGANVLPMAPEYN
RWEGETWPELKRLAETCPEAGIHFQKAVLYRRAQDEAAGFAGPLSDGLFVRNPWYKDLVP
DYVDLPASEVPEGMSSASSFTSVCINTAIYLPWLVGQCRARGVVFKRAVLKHISDAAKLS
HTGRKPDIIINATGLLSCRLGGVMDKKVMPARGQVVLVRNEATPNMVCTSGTDDGNGDEL
CYIMQRAAGGGTILGGTYMKGNWDGVPDPNIATRIMKRAVEACPALTGGKGIEALDVIRH
AVGLRPYREGGVRIDKENINGTWVVHNYGHGGWGYQGSWGCAFRVQELVDEIKSELKLGS
KL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccactattgttgttgtaggcgccggcgtgagcggcctcacttgcgcccttcaacta
gccaagcaaggaggaaacaccatcaccgtagtagccaagcacatgcccggcgactatgac
ccggagtacacctctcccttcgcgggcgccaacgtcctgcccatggcccccgaatacaac
cgctgggaaggcgaaacctggcccgaactgaaaagactcgctgagacctgtcctgaagcc
ggcatccacttccaaaaggccgtcctctaccgacgcgcccaagacgaagccgccggcttc
gcgggccccttgtccgacggcctctttgtgcgcaatccgtggtacaaagacctggtgccc
gactacgtcgacttaccggcctccgaggtgccagagggcatgtcctccgcctcttctttt
acttcggtctgcatcaacacggccatctacctcccctggctggtgggccagtgccgggca
cgcggcgtggtgtttaagcgggccgtgctcaagcacatctccgacgccgccaagttgagc
cacacggggcgcaagccggatatcatcatcaacgccacgggcttgctgagttgtcggctg
ggcggcgtcatggacaaaaaagtgatgcccgcgcgcggacaggtggtgctagtccgcaac
gaggcgacgccaaacatggtgtgcacgagcggcacggacgatgggaacggcgatgagttg
tgctacatcatgcagcgagctgcaggtgggggcacgattcttggaggtacctacatgaag
ggtaactgggacggcgtgccagatccgaacattgcgacgaggatcatgaagcgcgccgtg
gaggcgtgcccggcgttgacgggtggaaaaggtatcgaggcgctggatgtcattaggcat
gcggtggggctgaggccatatagagagggcggcgtgaggatcgacaaggaaaacatcaat
gggacgtgggtggtgcataactatggacatggcggatggggatatcagggcagctggggg
tgtgcgtttagggtgcaggagctggtggatgagattaagagtgagttgaagcttggctct
aagctctag

DBGET integrated database retrieval system