KEGG   Neurospora crassa: NCU06638Help
Entry
NCU06638          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
V
AA seq 1300 aa AA seqDB search
MGSHSDISINATGARVAVQQPAPTRTARSGSILRRPSITNGTSRQAGLGTTASNTSGVTT
PTAPAAIRTRRPNHYPPVSSTNNTMKAPRRSAGSDVLGNSDAEARRRRPSVASLGERNGT
EPVRTSVSVDGGPRPMPESTRTSKARSVQPPPRGSDGATLAHDLSALSLGSGSSPVTFPR
SPKTAVKAPVPSSTKRISVMPGVPHTSHATGLGARTVSPTDTKLMKRMSHNQPSQAPAPV
PTAPMPLATSRPSSRSPSMLPRKIPTPASSRTTPDVSIRKSYSSGLSAASANSYNTVRSS
TGSMQPRVPQSGNTRLPAPKGVPPQNTANGEEEEEVPPVPAIPKLYDSPGELSFLDKRKS
NRAFDTSSINSTSTGSVSGAQLTDPPPAKLHRKPSQRKSVHTSTVDKKSSSANSKKNLQP
LRLPPLALGPLSTTTAAKIAALQEQNASDRSLSPPPGRQIAKTPSTPMTASRSAYFTTTR
NEDKPTVQHLRSTSTINRGKGGSMDSYSSNESMGGVVSNVMPQSGMSPYILSSAVKGGNQ
ESTYSNRPKTGDPDASVPTQKPSGPRAPKPAAAKSSTAKSPPPPTDPEEPPTPSSIGTSI
RRKLSLSWKRSASKNGNNRPEKVDSSSVRHDSMPPPRIPISATLGSMPSTTKAPSPTPSS
KSNGTGTYLESRRRKSSASSLNAIVAGDRHRGEAAAGKKESSLDTVAERSIHTYSSAQKI
LKPKSSGATLSQPRDVWTADLDKDDMVAEEEMKKLGSRRKETEMAARTLDALRKRATAKE
RVGPQEALRIAVLNIYERGEIVDYKDVYFCGTQNAAKVVGNVQSDLPNFGYDDERGDYSI
IIGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTGVLVAVKIIRNKKRFHQQALVEVNILQK
LREWDPKNKHSMVNFTHSFYFRGHLCISTELLDMNLYEFIKSNAFRGFSLKLIRRFTKQM
LSSLLLLKQHKVIHCDLKPENILLRHPLHSEIKVIDFGSSCFENEKVYTYIQSRFYRSPE
VILGMTYGLPIDMWSLGCILAELFTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRK
KLFFDSSGKPRLTVSSKGRRRRPSSKTLQQVLKCDDQPFLDFIARCLRWDPDRRMKPEEA
VRHEFITGQKTPPSSSMPVPRLASTRESSPSKRVQNLNGGPRPLPEPPAAAVTTRTSLRS
GVVSSGMPQGPLKPTLASGMLPSSRKVSGVTASASGATSGVKRASGGTTGSTAGGFNSGN
VGSNGSSLPRAAIRTTSARQQQQQDLAAAGATAAMMSRRA
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atggggagccattccgacatttccatcaatgccaccggcgcgagagtcgcggtccagcag
ccggccccgacgcggaccgccagaagcgggtcaattttgagaagacccagtataaccaat
ggcacaagtagacaggcaggcttaggaacaacagcatccaacacttcgggtgttacgact
cctaccgctccggccgccatccgcacccgtcgtccgaaccactaccccccagtttcaagt
acgaacaatacgatgaaagctcccaggcggtcggctggatctgacgtgctcggtaactcg
gatgcggaggcacgaagacgaaggccaagtgtcgcctcactcggggagcgaaatggaaca
gagccggttcgcacgtcagtgtccgtagacggagggccccgtcccatgcccgagtcaacg
cgaacttccaaggcgagatctgtgcaaccaccgccccggggcagcgatggtgctacacta
gcccacgacttgagcgcccttagcttgggttccggtagctcacctgtgacatttccacgc
tccccgaagactgcggtcaaggcgccagttccatcctcgaccaagaggatatctgttatg
cctggtgttcctcatacttcacatgcaacaggcttaggtgccaggacggtcagcccgacg
gatacgaaattgatgaagcggatgtcccataaccaaccctcccaagcgccagctccagtg
ccaacagctccgatgccattagctacatcacgtccttcgtctcgttctccatccatgttg
ccgcgcaagatcccaacgccagcttcctctcggactaccccggacgtgagcatcagaaaa
tcctacagctcgggtctttcggctgcgtcagcaaatagctataataccgtacgatcatcg
actggctctatgcaaccgcgtgtcccgcaaagcggcaacactaggctacctgctcccaag
ggtgtgcctccgcagaatacggcgaacggcgaggaagaggaagaggtccccccagttcca
gcaataccaaagctgtacgactcgcccggggaactgtcgtttttggacaagcgcaagtcc
aatagagcatttgatacgagtagcatcaatagcacttctacagggagcgtatctggggca
cagctgactgacccaccgcctgctaagctgcaccgcaaaccgagccaacgaaagtccgta
cacacttcgactgtggataagaagtcctcttccgcaaactcaaagaaaaacctgcagcct
cttcgtctgccccctcttgctctaggaccgttgagcactacaactgctgccaaaattgcg
gcgcttcaggagcagaatgcatcagacaggagtctttctcctcctcctggcaggcagatt
gcaaagacgccgtcgacgcccatgaccgcgtcaagaagcgcctacttcaccacaacacga
aatgaggataagcctacagtgcagcatctcaggagtacaagcacaattaatcgaggaaag
ggcggtagtatggactcctacagctcaaacgagtcaatggggggagtggtgtcgaatgtg
atgccacagtcagggatgtcgccatatattttgtcttctgcggtaaagggggggaatcag
gagtcgacatactccaatcgaccaaaaacaggggatcccgatgcatctgttccaacccag
aaaccctctggaccgcgagccccgaagcctgctgccgcaaagtcatcaaccgcgaaatca
cccccacctcccactgacccggaagagccaccgactccatcgtcaattggcacctctatc
agacggaaattgagtctatcatggaaacgaagtgcatccaagaacggcaacaatcggcct
gaaaaggtggattcaagcagtgtcagacatgattctatgccacccccaaggatcccgata
tcggcaactttgggtagcatgccttcaaccacgaaagccccaagcccgacgccttcatca
aaatcgaatggaaccgggacatacttggagtctaggagacggaagagctcagcctcgagc
ctcaatgccattgttgcaggggaccgtcatcgtggcgaggcggcggcaggcaagaaggaa
tctagtctagacacggtggcagagcgatcgattcatacgtatagctcggcgcaaaagatt
ctcaagccgaagagttcaggtgcgactctgagccaaccccgtgacgtctggacggccgat
ctcgacaaggatgatatggtggccgaggaagagatgaagaaactcgggtcgcggcgtaag
gaaacggaaatggcggctcggacgctcgatgccttgcgcaagcgtgcaactgccaaggaa
cgcgttggtcctcaggaagccctcaggattgccgttctaaacatttacgaacgcggcgaa
attgtggattacaaggacgtctacttctgcggtactcagaatgcggccaaggtcgttggt
aacgttcaatcggaccttcccaactttgggtacgatgatgagcgaggagactactcgatt
attatcggcgatcatcttgcatacagatatgaaatcattgatgttcttggaaagggtagc
ttcgggcaggttgttcgatgcatcgatcataagactggcgtccttgtggccgtcaaaatc
atccgaaacaagaagcggttccaccagcaggctcttgtggaagtcaatatcctgcagaag
cttcgcgaatgggaccccaagaataagcacagcatggtgaatttcacccacagcttctat
ttccgtgggcatctctgcatttccaccgaattacttgatatgaatctttacgagtttatc
aagtccaacgctttccggggcttctctctcaagttgattcggcggttcactaaacaaatg
ctcagctcactgcttctgctcaagcagcacaaggttattcattgcgacttgaagccagaa
aacatccttctgcgacaccctctacactcggagatcaaggtcattgattttggttccagc
tgtttcgaaaacgagaaggtttatacttacattcagtcacgcttttaccgatcccccgag
gttatcctgggtatgacctatggccttcccattgatatgtggtcgctgggctgcattctg
gcggaactcttcactggagttcccattttccctggcgagaacgagcaggaacagctggca
tgcatcatggaagtattcgggcctccggagaagcacctcattgaaaagtcaacacgcaag
aaactcttcttcgatagctctggcaagccgcgtcttaccgtctcctcgaagggccgccgc
cgccgcccctcttccaagaccttgcagcaggttctcaagtgcgatgatcaaccattcttg
gatttcattgctcgatgcctcaggtgggatccggatagaagaatgaagcccgaagaagcc
gtacgacatgagttcatcaccggacaaaagactccgccctcgtcttccatgccagtgcca
cgccttgcatcgacgcgggaatcatccccaagcaagcgtgtacagaatctgaacggagga
cctcgcccgctgccggagccgccggccgccgctgtcaccaccagaacctcactacggtca
ggagttgtcagttctggtatgcctcagggtcctttaaaacccactcttgctagtggtatg
ttgccttcctcccgtaaggtctctggcgtgacggcttcggctagtggggcaacgtctggc
gtgaaaagagcaagtggaggtacaactggctcaacagctggcggtttcaactccggaaat
gttggttccaatgggagcagtctaccgcgagcggcgattcgtaccacgagtgcccggcag
caacagcaacaagatctcgcagccgcaggggccacagcagccatgatgagccgcagggcc
tag

DBGET integrated database retrieval system