KEGG   Neurospora crassa: NCU06638Help
Entry
NCU06638          CDS       T01034                                 

Gene name
stk-46
Definition
(RefSeq) serine/threonine protein kinase-46
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
ncr  Neurospora crassa
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCU06638 (stk-46)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCU06638 (stk-46)
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   NCU06638 (stk-46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group V; V
AA seq 1363 aa AA seqDB search
MLSASSSNNHSLFSFGSRNGNEDGSSTNTAFEFLPSVSFDDLQSSLELAHYSTPPGQNSS
PESMGSHSDISINATGARVAVQQPAPTRTARSGSILRRPSITNGTSRQAGLGTTASNTSG
VTTPTAPAAIRTRRPNHYPPVSSTNNTMKAPRRSAGSDVLGNSDAEARRRRPSVASLGER
NGTEPVRTSVSVDGGPRPMPESTRTSKARSVQPPPRGSDGATLAHDLSALSLGSGSSPVT
FPRSPKTAVKAPVPSSTKRISVMPGVPHTSHATGLGARTVSPTDTKLMKRMSHNQPSQAP
APVPTAPMPLATSRPSSRSPSMLPRKIPTPASSRTTPDVSIRKSYSSGLSAASANSYNTV
RSSTGSMQPRVPQSGNTRLPAPKGVPPQNTANGEEEEEVPPVPAIPKLYDSPGELSFLDK
RKSNRAFDTSSINSTSTGSVSGAQLTDPPPAKLHRKPSQRKSVHTSTVDKKSSSANSKKN
LQPLRLPPLALGPLSTTTAAKIAALQEQNASDRSLSPPPGRQIAKTPSTPMTASRSAYFT
TTRNEDKPTVQHLRSTSTINRGKGGSMDSYSSNESMGGVVSNVMPQSGMSPYILSSAVKG
GNQESTYSNRPKTGDPDASVPTQKPSGPRAPKPAAAKSSTAKSPPPPTDPEEPPTPSSIG
TSIRRKLSLSWKRSASKNGNNRPEKVDSSSVRHDSMPPPRIPISATLGSMPSTTKAPSPT
PSSKSNGTGTYLESRRRKSSASSLNAIVAGDRHRGEAAAGKKESSLDTVAERSIHTYSSA
QKILKPKSSGATLSQPRDVWTADLDKDDMVAEEEMKKLGSRRKETEMAARTLDALRKRAT
AKERVGPQEALRIAVLNIYERGEIVDYKDVYFCGTQNAAKVVGNVQSDLPNFGYDDERGD
YSIIIGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTGVLVAVKIIRNKKRFHQQALVEVNI
LQKLREWDPKNKHSMVNFTHSFYFRGHLCISTELLDMNLYEFIKSNAFRGFSLKLIRRFT
KQMLSSLLLLKQHKVIHCDLKPENILLRHPLHSEIKVIDFGSSCFENEKVYTYIQSRFYR
SPEVILGMTYGLPIDMWSLGCILAELFTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKS
TRKKLFFDSSGKPRLTVSSKGRRRRPSSKTLQQVLKCDDQPFLDFIARCLRWDPDRRMKP
EEAVRHEFITGQKTPPSSSMPVPRLASTRESSPSKRVQNLNGGPRPLPEPPAAAVTTRTS
LRSGVVSSGMPQGPLKPTLASGMLPSSRKVSGVTASASGATSGVKRASGGTTGSTAGGFN
SGNVGSNGSSLPRAAIRTTSARQQQQQDLAAAGATAAMMSRRA
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgcctcctcgtccaacaaccattcattgttctcctttggcagccggaatggt
aacgaagacggatcatcgacaaatacagcattcgaattcttgccctcggtgagcttcgac
gatcttcagagcagcctcgagttggcccactactcaacaccacctggtcaaaattcttca
cccgaaagcatggggagccattccgacatttccatcaatgccaccggcgcgagagtcgcg
gtccagcagccggccccgacgcggaccgccagaagcgggtcaattttgagaagacccagt
ataaccaatggcacaagtagacaggcaggcttaggaacaacagcatccaacacttcgggt
gttacgactcctaccgctccggccgccatccgcacccgtcgtccgaaccactacccccca
gtttcaagtacgaacaatacgatgaaagctcccaggcggtcggctggatctgacgtgctc
ggtaactcggatgcggaggcacgaagacgaaggccaagtgtcgcctcactcggggagcga
aatggaacagagccggttcgcacgtcagtgtccgtagacggagggccccgtcccatgccc
gagtcaacgcgaacttccaaggcgagatctgtgcaaccaccgccccggggcagcgatggt
gctacactagcccacgacttgagcgcccttagcttgggttccggtagctcacctgtgaca
tttccacgctccccgaagactgcggtcaaggcgccagttccatcctcgaccaagaggata
tctgttatgcctggtgttcctcatacttcacatgcaacaggcttaggtgccaggacggtc
agcccgacggatacgaaattgatgaagcggatgtcccataaccaaccctcccaagcgcca
gctccagtgccaacagctccgatgccattagctacatcacgtccttcgtctcgttctcca
tccatgttgccgcgcaagatcccaacgccagcttcctctcggactaccccggacgtgagc
atcagaaaatcctacagctcgggtctttcggctgcgtcagcaaatagctataataccgta
cgatcatcgactggctctatgcaaccgcgtgtcccgcaaagcggcaacactaggctacct
gctcccaagggtgtgcctccgcagaatacggcgaacggcgaggaagaggaagaggtcccc
ccagttccagcaataccaaagctgtacgactcgcccggggaactgtcgtttttggacaag
cgcaagtccaatagagcatttgatacgagtagcatcaatagcacttctacagggagcgta
tctggggcacagctgactgacccaccgcctgctaagctgcaccgcaaaccgagccaacga
aagtccgtacacacttcgactgtggataagaagtcctcttccgcaaactcaaagaaaaac
ctgcagcctcttcgtctgccccctcttgctctaggaccgttgagcactacaactgctgcc
aaaattgcggcgcttcaggagcagaatgcatcagacaggagtctttctcctcctcctggc
aggcagattgcaaagacgccgtcgacgcccatgaccgcgtcaagaagcgcctacttcacc
acaacacgaaatgaggataagcctacagtgcagcatctcaggagtacaagcacaattaat
cgaggaaagggcggtagtatggactcctacagctcaaacgagtcaatggggggagtggtg
tcgaatgtgatgccacagtcagggatgtcgccatatattttgtcttctgcggtaaagggg
gggaatcaggagtcgacatactccaatcgaccaaaaacaggggatcccgatgcatctgtt
ccaacccagaaaccctctggaccgcgagccccgaagcctgctgccgcaaagtcatcaacc
gcgaaatcacccccacctcccactgacccggaagagccaccgactccatcgtcaattggc
acctctatcagacggaaattgagtctatcatggaaacgaagtgcatccaagaacggcaac
aatcggcctgaaaaggtggattcaagcagtgtcagacatgattctatgccacccccaagg
atcccgatatcggcaactttgggtagcatgccttcaaccacgaaagccccaagcccgacg
ccttcatcaaaatcgaatggaaccgggacatacttggagtctaggagacggaagagctca
gcctcgagcctcaatgccattgttgcaggggaccgtcatcgtggcgaggcggcggcaggc
aagaaggaatctagtctagacacggtggcagagcgatcgattcatacgtatagctcggcg
caaaagattctcaagccgaagagttcaggtgcgactctgagccaaccccgtgacgtctgg
acggccgatctcgacaaggatgatatggtggccgaggaagagatgaagaaactcgggtcg
cggcgtaaggaaacggaaatggcggctcggacgctcgatgccttgcgcaagcgtgcaact
gccaaggaacgcgttggtcctcaggaagccctcaggattgccgttctaaacatttacgaa
cgcggcgaaattgtggattacaaggacgtctacttctgcggtactcagaatgcggccaag
gtcgttggtaacgttcaatcggaccttcccaactttgggtacgatgatgagcgaggagac
tactcgattattatcggcgatcatcttgcatacagatatgaaatcattgatgttcttgga
aagggtagcttcgggcaggttgttcgatgcatcgatcataagactggcgtccttgtggcc
gtcaaaatcatccgaaacaagaagcggttccaccagcaggctcttgtggaagtcaatatc
ctgcagaagcttcgcgaatgggaccccaagaataagcacagcatggtgaatttcacccac
agcttctatttccgtgggcatctctgcatttccaccgaattacttgatatgaatctttac
gagtttatcaagtccaacgctttccggggcttctctctcaagttgattcggcggttcact
aaacaaatgctcagctcactgcttctgctcaagcagcacaaggttattcattgcgacttg
aagccagaaaacatccttctgcgacaccctctacactcggagatcaaggtcattgatttt
ggttccagctgtttcgaaaacgagaaggtttatacttacattcagtcacgcttttaccga
tcccccgaggttatcctgggtatgacctatggccttcccattgatatgtggtcgctgggc
tgcattctggcggaactcttcactggagttcccattttccctggcgagaacgagcaggaa
cagctggcatgcatcatggaagtattcgggcctccggagaagcacctcattgaaaagtca
acacgcaagaaactcttcttcgatagctctggcaagccgcgtcttaccgtctcctcgaag
ggccgccgccgccgcccctcttccaagaccttgcagcaggttctcaagtgcgatgatcaa
ccattcttggatttcattgctcgatgcctcaggtgggatccggatagaagaatgaagccc
gaagaagccgtacgacatgagttcatcaccggacaaaagactccgccctcgtcttccatg
ccagtgccacgccttgcatcgacgcgggaatcatccccaagcaagcgtgtacagaatctg
aacggaggacctcgcccgctgccggagccgccggccgccgctgtcaccaccagaacctca
ctacggtcaggagttgtcagttctggtatgcctcagggtcctttaaaacccactcttgct
agtggtatgttgccttcctcccgtaaggtctctggcgtgacggcttcggctagtggggca
acgtctggcgtgaaaagagcaagtggaggtacaactggctcaacagctggcggtttcaac
tccggaaatgttggttccaatgggagcagtctaccgcgagcggcgattcgtaccacgagt
gcccggcagcaacagcaacaagatctcgcagccgcaggggccacagcagccatgatgagc
cgcagggcctag

DBGET integrated database retrieval system