KEGG   Neurospora crassa: NCU06760Help
Entry
NCU06760          CDS       T01034                                 

Definition
similar to pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 417 aa AA seqDB search
MSWKMSEKLMDTIRHYASFPATGVSLRQMVQFGEKPSTGTLFRASQFLAEELPIRLAHRV
QELDNLPDGLNEMPSVKKVQAWYAQSFEPSRSGKHAYLPEATPNPSIEEGQYASHNGASY
ASGLNHKKFSASRRYFAMVDDTGDWPPDLHLYNQKFAQTLHKIKRRHDSVVTTMAQGILE
YKRKRQRMQIDHNIQSFLDRFYMSRIGIRMLIGQHIALTDQNHYRDPSYVGIICTKTYVK
DLAQEAIENARFVCEDHYGLFEAPKIQLVCNPNLNFMYVPGHLSHMLFETLKNSLRAVVE
THGQDKQEFPVTKVIVAEGKEDITIKISDEGGGIPRSAIPLVWTYMYTTVDRTPNLDPDF
DKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaaaatgagcgagaagctcatggacaccatccggcactatgcgagctttcct
gccaccggcgtcagcttgcgccagatggtccagttcggcgagaagccttctactggaacc
ctcttccgcgcctcccaattccttgctgaagagctccccatccgtctcgcccacagagtc
caggagcttgataaccttccagatggccttaacgagatgccttcggtcaagaaggtccag
gcctggtatgcccaatcgttcgagccgtcgagaagcggaaaacacgcctatctaccagag
gcgacaccaaaccccagcatagaggaaggccagtacgcctcacacaacggagcaagctac
gcaagcggactgaaccacaaaaagttctcggcctcaaggagatactttgctatggttgat
gacacaggggattggcctcccgacctacacctttacaaccagaaatttgcgcagactctg
cacaagatcaagaggcggcacgacagtgtcgtcaccaccatggcccagggcatcctcgag
tacaagcgcaaaaggcaacgcatgcagatcgaccacaacatccagtctttcctcgaccgc
ttctacatgtcgcgcataggcataagaatgctgattgggcagcacatcgccctgacggac
cagaaccattatcgcgatccctcatatgtcggtattatctgcaccaagacgtatgtcaag
gacctcgcccaggaggccattgagaacgcccggtttgtttgcgaggatcactacggtctc
tttgaggctcccaagatccagctggtttgcaaccctaacctcaacttcatgtatgtaccg
gggcatctgtcgcacatgctcttcgagacgctcaagaactcgctgcgcgccgtcgtcgag
acccacggccaggacaagcaggaattccccgtcaccaaggtcattgttgctgagggcaag
gaagacatcaccatcaagatctcggatgaaggaggcggtattccccgtagcgctatcccg
cttgtttggacctacatgtacaccaccgtcgatcgcacacccaacctggatcccgacttc
gacaagagcgactttaaggcccccatggccggtttcggctacggacttcctatctcgcgc
ttgtatgcgagatactttggtggcgaccttaagttgatcagcatggaaggatacggaacc
gatgtctacctgcacctcaacaggttgtcaagttcgtcagaacctctgcaatag

DBGET integrated database retrieval system