KEGG   Neurospora crassa: NCU06836Help
Entry
NCU06836          CDS       T01034                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ncr  Neurospora crassa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCU06836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU06836
   00620 Pyruvate metabolism
    NCU06836
   00640 Propanoate metabolism
    NCU06836
  Energy metabolism
   00680 Methane metabolism
    NCU06836
Enzymes [BR:ncr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NCU06836
Lipid biosynthesis proteins [BR:ncr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NCU06836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II
AA seq 667 aa AA seqDB search
MSGSTVPAGAVVPEAHTIETFQPPREMLQNHPSKPHLANFEEYQKLYKQSITEPNVFWAE
RARELLSWSKDFQTVHSGSLANGDNAWFVEGELNASYNCVDRHAHKDPNRVAIIYEADEP
GQGRNVTYGELLREVSKLAHVLTNLGVRKGDTVAIYLPMIPEAIVAMLACTRIGAIHSVV
FAGFSSDSLRDRVVDAQSKVVITTDEGKRGGKLIGTKKIVDEALQQCPDVRNVLVYKRTG
ADISMTPGRDLWWHEEVEKYPAYYTPVAMASEDPLFLLYTSGSTGKPKGVAHSTGGYLLG
AAMTGKYVFDIHDGDRYFCGGDVGWITGHTYVLYAPLLLGVSTVVFEGTPAYPNFSRYWD
IIEEHKVTQFYVAPTALRLLKRAGDHHVRNEMKHLRVLGSVGEPIAAEVWKWYYDVVGKG
RAQICDTYWQTETGSNVITPLAGVTPTKPGSASFPFFGIEPALVDPVTGEEIHGNDVEGV
LAFKQPWPSMARTVWGAHKRYMETYLHVYKGYYFTGDGAARDHEGFYWIRGRVDDVVNVS
GHRLSTAEIEAALIEHHSIAEAAVVGVADELTGQAVNAFVAVKEGTQINDALRKEFVLQV
RRSIGPFAAPKAIYIVPDLPKTRSGKIMRRILRKIVAGEEDQLGDITTLSDPSVVAKIID
VVHAQRQ
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtagcaccgttcctgccggggcagtagtgcccgaggctcacactattgagacc
ttccagccccctagggagatgcttcagaaccacccaagcaaacctcatcttgccaacttt
gaggagtaccagaagctgtacaagcagtccatcaccgagcccaacgtgttctgggctgag
cgcgcccgcgagcttctgtcgtggagcaaggatttccagacggtccacagcggctccctc
gccaacggtgacaacgcctggttcgtagagggcgagctcaacgcctcgtacaactgcgtc
gacagacacgcccacaaggaccccaacagagtcgccatcatctacgaggccgacgagccc
ggtcagggaaggaatgtcacctatggcgagctcctcagggaggtctccaagctcgcccat
gtcctcaccaacttgggtgttcgcaagggagacaccgtcgccatctaccttcccatgatt
cccgaggccatcgttgccatgcttgcttgcaccagaattggcgccatccactccgtcgtt
tttgccggcttctcctccgactccctccgcgaccgtgtcgtcgatgcccagtccaaggtt
gtcatcaccaccgatgagggcaagcgcggtggcaagctgattggcaccaagaagatcgtc
gacgaggctctccagcagtgccccgatgttcgcaacgtgctcgtctacaagcgcaccggc
gccgacatcagcatgacccccggccgtgatctctggtggcacgaggaggttgagaagtac
cctgcttactacacccctgtggccatggcctcggaggatcctctcttccttctctacacc
tctggctccactggcaagcccaagggagttgcccactctaccggtggttacctgctcggt
gctgccatgaccggcaagtacgttttcgacatccatgacggcgacaggtatttctgcggt
ggtgacgtcggctggattaccggtcacacctatgtcctctacgccccgctcttgctcggt
gtctctaccgtcgttttcgagggtacccccgcctaccccaacttctcccgctactgggac
atcattgaggagcacaaggtcactcagttctacgttgctcccactgccctgcgcctgctg
aagcgcgccggtgaccatcacgttcgcaacgagatgaagcacctccgtgttctcggctct
gtcggtgagcccatcgccgccgaggtctggaagtggtactatgatgttgtcggcaagggc
cgcgcccagatttgcgacacctactggcagaccgagactggctccaacgtcatcactccc
cttgccggcgttacccccaccaagcccggttccgcttctttccccttcttcggtatcgag
cccgcgcttgtcgaccccgttaccggcgaggagatccacggcaacgacgttgagggtgtc
ttggccttcaagcagccctggcccagcatggctcgcaccgtctggggtgcccataagcgc
tacatggagacctacctccatgtgtacaagggctactacttcacgggcgacggtgctgcc
cgcgatcacgagggcttctactggatccgcggccgtgtcgacgacgtcgtcaacgttagt
ggccaccgtctcagcactgccgagattgaggctgctctgattgagcatcactccattgcc
gaggctgctgttgttggtgttgccgacgagctcactggccaggccgtcaacgccttcgtt
gccgtcaaggagggtacccagatcaacgatgctctccgcaaggagttcgtcctccaggtc
cgccgcagcatcgggcccttcgctgctcccaaggccatctacatcgttcctgatcttccc
aagactcgctctggcaagatcatgcgccgcattctgaggaagattgttgccggcgaggaa
gatcagcttggtgatatcactactctcagcgatcccagcgtcgttgccaagatcatcgat
gtcgtccacgcgcagcgccagtaa

DBGET integrated database retrieval system