KEGG   Neurospora crassa: NCU06939Help
Entry
NCU06939          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ncr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 606 aa AA seqDB search
MPCLKPAELLLALPQKESSLAAGIGSALALPAARPNGGVEAAAKYTATMGSATIEAGSRP
MNVREISEKAKQYDWNPRIGFKFWARAANTIHHEGQIYLQEGSIAQAYMFLLRYCTLVLE
DMAKHPEAKLPENRSLMKQLNARINTVVEQLEQLKPQIEEAYAKWQQLTASVQDSREKRL
STSSQYSRHAANDAALSWNHLSQAKILDAGSNQELAVDLAREALLKRRRRRRQESADEDE
RMHRPPSGYREERGYDAGRRQQYPTPPLTHHRYSEDDDLRRQMEATRRQLDRSGGYGVSE
TDNGTSDTDSYQSVNYHYPAIKPTSTYTYDYPKPASRPESPKPQPPLPPKVIPFERPVPV
TRPPPPPPRPRKGSGSLNRDSRRNVMLPSQTIRLPKEANKVTFRPVAYLESGEPLRSVFL
PSGLRRRFLELARGNTIRELEMCGILCGTLINNALFITCLLIPEQECTSDTCETINEEAY
VTYCIENDLLVLGWIHTHPTQTCFMSSRDLHTHAGYQTMMKESIAIVCAPRYDPSYGIFR
LTDPPGLPHIINCNTPGVFHQHAIPSDEIYCSARHAPGHVFESSRVDFEVVDLRPEGSKV
PPFKRY
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtctcaagcctgccgagctgttgctggcgcttccacagaaggaaagcagcctg
gcggcaggcattggatctgctctcgcactgcccgccgcgcggcccaatggcggggtcgag
gcggccgccaagtacacggcgaccatgggaagcgcaacgatagaggccgggagccggccc
atgaatgtcagggagatatccgagaaagcaaagcaatacgactggaatccccggattggc
ttcaagttctgggcgcgcgctgccaacaccatccatcatgagggtcagatctaccttcaa
gaaggaagcatagcgcaagcttacatgtttctgctccgctactgcaccctcgtcctcgag
gatatggcgaagcacccggaagccaaactccccgaaaaccgaagtctgatgaagcaactg
aacgcacgcataaacaccgtggttgaacagcttgaacagctcaagccccagatagaggag
gcctatgcgaagtggcagcagctcacggccagcgtacaagacagcagggagaagcggcta
tctacatcttcccaatactctagacacgctgccaacgacgctgctctgtcatggaaccat
ctttctcaggctaagatcctggatgctggatcaaaccaagagttggcagtcgaccttgct
agggaggcgctgcttaagcgacggagacgacgacggcaagagagtgctgatgaagatgaa
cgcatgcacaggcctccatcaggttacagagaggagagaggttatgatgcgggcaggaga
cagcaatatcctactccaccactaacgcaccatcgctattcggaagacgatgaccttcgc
cggcaaatggaggctacaagacgacaattggaccgctcgggaggctacggggtttcggaa
actgacaacggtaccagcgacactgacagctatcaatccgtcaactatcactacccagcc
atcaaaccgacatctacttatacctacgactacccgaagccggcctcacggccggaaagc
ccaaaaccacagccaccacttccgcccaaggtgatcccctttgagcgaccagtacccgta
accagacctcctccaccacctccacgcccacggaagggttcggggtcgttgaacagagat
tcaaggaggaatgttatgcttcctagtcagactattcgactaccaaaagaagcgaacaaa
gtcaccttccgccccgtcgcctacctcgaaagcggcgaacctctccgatccgtgttcctc
cccagcggtctccgccgtcgtttcctcgaactagcccgtggaaacaccatcagggagctg
gagatgtgcggcatcctctgtggcacgctcatcaataatgccctgttcatcacctgcctg
ctcattcctgaacaagagtgcacctcggacacatgcgagaccatcaacgaggaagcgtac
gtcacgtactgcatcgagaacgacctgctcgtcctcggttggatccacactcatccgacg
cagacgtgcttcatgagctcgagagacttgcatacccatgccggataccagaccatgatg
aaggagagcattgccattgtttgtgcgccgagatatgatccctcatacggtatcttccgc
ctcacggaccctcccggtctcccacacatcatcaactgcaacacccccggcgtcttccat
cagcacgccattccctccgacgagatttactgtagtgcccgtcatgcaccagggcacgtg
tttgagtcaagcagggttgactttgaggtggtggatctgaggcctgaggggtccaaggtg
ccgccgttcaagaggtattag

DBGET integrated database retrieval system