KEGG   Neurospora crassa: NCU06939Help
Entry
NCU06939          CDS       T01034                                 

Definition
(RefSeq) endosome-associated ubiquitin isopeptidase
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCU06939
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU06939
Peptidases [BR:ncr01002]
 Metallo Peptidases
  Family M67
   NCU06939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group VII; VII
AA seq 586 aa AA seqDB search
MGSATIEAGSRPMNVREISEKAKQYDWNPRIGFKFWARAANTIHHEGQIYLQEGSIAQAY
MFLLRYCTLVLEDMAKHPEAKLPENRSLMKQLNARINTVVEQLEQLKPQIEEAYAKWQQL
TASVQDSREKRLSTSSQYSRHAANDAALSWNHLSQAKILDAGSNQELAVDLAREALLKRR
RRRRQESADEDERMHRPPSGYREERGYDAGRRQQYPTPPLTHHRYSEDDDLRRQMEATRR
QLDRSGGYGVSETDNGTSDTDSYQSVNYHYPAIKPTSTYTYDYPKPASRPESPKPQPPLP
PKVIPFERPVPVTRPPPPPPRPRKGSGSLNRDSRRNVMLPSQTIRLVTDEDDVDDKPARP
PKVSEPLPPPPETQPKEANKVTFRPVAYLESGEPLRSVFLPSGLRRRFLELARGNTIREL
EMCGILCGTLINNALFITCLLIPEQECTSDTCETINEEAYVTYCIENDLLVLGWIHTHPT
QTCFMSSRDLHTHAGYQTMMKESIAIVCAPRYDPSYGIFRLTDPPGLPHIINCNTPGVFH
QHAIPSDEIYCSARHAPGHVFESSRVDFEVVDLRPEGSKVPPFKRY
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcaacgatagaggccgggagccggcccatgaatgtcagggagatatccgag
aaagcaaagcaatacgactggaatccccggattggcttcaagttctgggcgcgcgctgcc
aacaccatccatcatgagggtcagatctaccttcaagaaggaagcatagcgcaagcttac
atgtttctgctccgctactgcaccctcgtcctcgaggatatggcgaagcacccggaagcc
aaactccccgaaaaccgaagtctgatgaagcaactgaacgcacgcataaacaccgtggtt
gaacagcttgaacagctcaagccccagatagaggaggcctatgcgaagtggcagcagctc
acggccagcgtacaagacagcagggagaagcggctatctacatcttcccaatactctaga
cacgctgccaacgacgctgctctgtcatggaaccatctttctcaggctaagatcctggat
gctggatcaaaccaagagttggcagtcgaccttgctagggaggcgctgcttaagcgacgg
agacgacgacggcaagagagtgctgatgaagatgaacgcatgcacaggcctccatcaggt
tacagagaggagagaggttatgatgcgggcaggagacagcaatatcctactccaccacta
acgcaccatcgctattcggaagacgatgaccttcgccggcaaatggaggctacaagacga
caattggaccgctcgggaggctacggggtttcggaaactgacaacggtaccagcgacact
gacagctatcaatccgtcaactatcactacccagccatcaaaccgacatctacttatacc
tacgactacccgaagccggcctcacggccggaaagcccaaaaccacagccaccacttccg
cccaaggtgatcccctttgagcgaccagtacccgtaaccagacctcctccaccacctcca
cgcccacggaagggttcggggtcgttgaacagagattcaaggaggaatgttatgcttcct
agtcagactattcgactagtaaccgacgaggacgatgtcgacgataagcccgcaagaccg
cccaaagtaagtgaaccgctgccgccgccgccagaaacgcagccaaaagaagcgaacaaa
gtcaccttccgccccgtcgcctacctcgaaagcggcgaacctctccgatccgtgttcctc
cccagcggtctccgccgtcgtttcctcgaactagcccgtggaaacaccatcagggagctg
gagatgtgcggcatcctctgtggcacgctcatcaataatgccctgttcatcacctgcctg
ctcattcctgaacaagagtgcacctcggacacatgcgagaccatcaacgaggaagcgtac
gtcacgtactgcatcgagaacgacctgctcgtcctcggttggatccacactcatccgacg
cagacgtgcttcatgagctcgagagacttgcatacccatgccggataccagaccatgatg
aaggagagcattgccattgtttgtgcgccgagatatgatccctcatacggtatcttccgc
ctcacggaccctcccggtctcccacacatcatcaactgcaacacccccggcgtcttccat
cagcacgccattccctccgacgagatttactgtagtgcccgtcatgcaccagggcacgtg
tttgagtcaagcagggttgactttgaggtggtggatctgaggcctgaggggtccaaggtg
ccgccgttcaagaggtattag

DBGET integrated database retrieval system