KEGG   Neurospora crassa: NCU07018Help
Entry
NCU07018          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCU07018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 1073 aa AA seqDB search
MRNVSYGGPPSRSQTPALRRKASMNSIQVAHNSNGHGLRRSSSVNLTPSAAKKSPLNDMS
PDTSEFKVPPTPQSIASDHFKAELEIHHGHDPKLSAETIVILNDACYGHRYSRPRTSKAS
LSTIVERPERIKASVLGVSAAYVRLGERHQDGSFPIHPDQHPSNLPSVPFLIQKTTRRLA
ITSPTVTNVHGTKWMEELKIMCDTAEAKLATNGKELQRPDMDRGPDAEEPPKFHEGDLYL
CAESLDAMEGALGGVCEAVDAVFKPEGPKRAFVAIRPPGHHCSASYPSGFCWVNNVHVGI
MHAILSHGLTHAAIIDFDLHHGDGSQQIAWQHNSRGVKAAKNAAMWKKTSIGYFSLHDIN
SYPCETGDDEKVMNASVCIDNAHGQNVWNVHLQPWETEEDFWALYESKYTVLLEKARSYL
VTQAERLRAAGQNAKAAIFLSAGFDASEWEGAGMQRHEVNVPTEFYARLTRDVVRIAAEV
DTAVEGRIVSVLEGGYSDRALCSGIMSHVCGLAGAGSTGNGKAHDQYNPSWWSAAALEHL
ETTLLTPPPEPPKPPRNVATPTYCSPTQASTARSVAPRRSMSGLHQHALMAANRPMSPMP
ARIPMPPAPEVPWAIAACELSKLLIPRDRQTDSCTHTDLNAEATKARRERQLAQANTSAS
DAGTANSSDRPSTRMALRERKAKQAVPIKEEDTDEDRVDAVSAGKTGVPRGGARATRSRR
LSAASTIVPDSLDSSPPSHRYSATNAEDDGRPETSMSIRPESSMSVRPQGNPLVVNKTRG
PAKSKNVLQAPRTQRQISTSTIESARSSNASLVSPASASLNDQPSTGSNGDGVDTVTGGM
KKVKITLITQAQKEARERERAAKENAGAISVVTSNLQENKLRQQQPTQTPVATVQSPTES
NTTSPAPSTQFYTPNSQGRNSFSSSEDMDATDKYPELFGHHHLQDGDGDIDMEDFEIPAL
ASTPMPSRTSFPLPLRPLQESSTPLENFIQYQPPAGKHQASVPAQTPTSPGQAMNRKDVP
VFTATSAIPFSPQKTEPLQQSPAPSTPASLPSVIFAGQKQEEKEEVVETPERN
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgcggaacgtatcctacggcgggccaccgtctcgctctcaaactcccgcacttcgccgc
aaagcctccatgaactcgatccaggtcgcccacaacagcaatggccatggacttcgtcga
tccagttcagtcaacctcacaccgtccgccgccaagaagtcacctttgaacgacatgtct
cctgatacgtccgagttcaaagtgccgcccaccccgcaatccatcgcgagtgaccacttc
aaggccgaacttgagattcatcacggacatgatccaaagctgtcggccgagaccattgtt
attctgaacgatgcatgctatggacatcgctattctcgaccccggacatccaaggcaagc
ctgagcaccatcgtcgaacgacccgagaggattaaggccagcgtcttgggagtgtcggcc
gcctatgtacgtctgggcgagcgacaccaagacggttcgttcccgattcatccggatcag
catcccagcaacctcccttcggtaccttttctcatacaaaagacgactcgacgactggcc
atcacatctccgacagtaaccaacgtacatggcacgaaatggatggaggaactcaagatc
atgtgcgataccgctgaagcgaagctggcgacgaatggcaaagaacttcaacgtccggat
atggatcgtggacctgatgcggaagagcctccaaagttccatgaaggtgacctctatctg
tgtgcagaatcactagatgctatggaaggagctctcggcggtgtctgtgaggccgtcgat
gcggtgtttaagcctgagggtccgaaaagggcttttgtagctattcgcccgcctggccac
cactgctccgcctcgtatccttcgggcttttgttgggttaacaacgttcatgtgggcatt
atgcacgcaattctgagccatggcttgacccatgccgccattatcgactttgacctccac
cacggtgatggctcccagcaaattgcttggcagcacaactcaagaggcgtaaaggctgca
aagaacgcagcgatgtggaagaagacctccattgggtacttcagccttcacgatatcaac
tcgtatccttgcgagaccggcgacgacgaaaaagttatgaacgcgagtgtatgcatcgac
aacgctcatggacagaatgtgtggaatgtgcacctacagccctgggagacagaagaggat
ttctgggcactctacgagtccaagtacaccgtcttgcttgagaaggcgcgcagctacctt
gtcacacaggcggagcgcttgcgagcagcaggccaaaacgccaaggcagccatctttctt
tctgctggtttcgatgccagcgaatgggagggcgctggaatgcagagacacgaagtcaac
gtccccacagagttctatgctcgattaacccgagatgtagtacggattgcagcagaagtg
gatacggctgtagagggccgaatcgtcagcgtactggagggaggatatagtgatcgggcg
ctttgctctggcatcatgagtcacgtttgcggccttgctggagctggttctactggaaat
ggcaaagctcatgatcagtacaacccttcgtggtggtctgctgctgcgcttgaacatttg
gaaaccacactgttgacccccccacccgaaccaccaaagccccctcggaacgttgcgact
cctacctactgttcacctacacaggcctctacggcacggtctgtagcgccacggagaagt
atgtccggactccatcagcacgcactcatggcagccaacaggccgatgtcaccaatgccg
gcgagaataccgatgccccctgctccagaggttccgtgggctattgctgcttgcgaactg
agcaagcttcttattccgcgcgaccgccaaacggatagctgtactcacacagatcttaat
gctgaggccaccaaggctcgtcgggagcgccagttagcccaggcgaatacttcggcgtcc
gatgctggcactgcaaactcgtcggatcggccctctacaaggatggccttaagggagcgt
aaggccaagcaagcagtgcctatcaaggaggaggacacagacgaagaccgagtggacgct
gtgtccgcaggaaagactggtgtgccccgaggaggcgctcgtgctacacgtagtcgacgc
cttagtgctgcttcgaccatcgtcccagacagccttgactcgtctcctccaagccacaga
tactcagccacaaatgcggaagatgatggaagaccggaaacatccatgagcatcaggccc
gagtcttcaatgagtgtcagaccgcaggggaaccctcttgtggtcaataagacgcggggg
ccagcaaagagcaagaatgttctgcaagcaccgaggacacagaggcagatttcaacttca
accatcgaatcagcaaggagctccaacgcatccctagtatcaccagcttcggcttccctt
aacgatcagccatcaactggtagcaatggcgacggcgtagatacagtgaccggcgggatg
aagaaggttaagattactcttatcacacaagcccagaaagaggctcgcgagcgggagcgt
gctgcgaaagaaaacgccggtgcgatttctgtcgttacatccaacctacaggaaaacaaa
cttcgtcaacaacagcctacgcagacacccgttgccacagtccaatctcccaccgaaagc
aacaccacctctcccgcgccatccacgcagttctacactcccaactcacaaggtcggaac
tcattttcctcctccgaagacatggacgccacggacaagtatccggagctttttgggcac
catcacctccaagacggggatggtgacatcgacatggaagatttcgaaatacccgctctt
gcatccacgcccatgcctagtcgtacttcattccctctaccgttgaggcctcttcaagag
tcttccactcccttggaaaacttcatacagtaccagcctcctgctggcaagcaccaggcc
tctgtaccagcacagacaccaactagtcccggacaagctatgaacagaaaggacgtgccc
gtgtttactgccacctcagccattcccttttcgccccagaagacggagccattgcagcag
tctccggcgccgtctacgcctgcttcattgccaagtgtgatctttgctggacagaagcag
gaagagaaggaagaggttgtggagacgccagagaggaattga

DBGET integrated database retrieval system