KEGG   Neurospora crassa: NCU07018Help
Entry
NCU07018          CDS       T01034                                 

Gene name
hda-4
Definition
(RefSeq) histone deacetylase-4
  KO
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCU07018 (hda-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group IV; IV
AA seq 1212 aa AA seqDB search
MPSSSSAAFHNRPSSSASVASSRSSATNPRRVSGVPAGAGSDVHTTPTSASNLQQRRLSR
TASKGQLDKNNADGDLTQSLNHLSISLASPSSVTSQSPSPRKSPRSANHPPPAISPLRPQ
FSTSTAGSPSGTPSRPGSAMRNVSYGGPPSRSQTPALRRKASMNSIQVAHNSNGHGLRRS
SSVNLTPSAAKKSPLNDMSPDTSEFKVPPTPQSIASDHFKAELEIHHGHDPKLSAETIVI
LNDACYGHRYSRPRTSKASLSTIVERPERIKASVLGVSAAYVRLGERHQDGSFPIHPDQH
PSNLPSVPFLIQKTTRRLAITSPTVTNVHGTKWMEELKIMCDTAEAKLATNGKELQRPDM
DRGPDAEEPPKFHEGDLYLCAESLDAMEGALGGVCEAVDAVFKPEGPKRAFVAIRPPGHH
CSASYPSGFCWVNNVHVGIMHAILSHGLTHAAIIDFDLHHGDGSQQIAWQHNSRGVKAAK
NAAMWKKTSIGYFSLHDINSYPCETGDDEKVMNASVCIDNAHGQNVWNVHLQPWETEEDF
WALYESKYTVLLEKARSYLVTQAERLRAAGQNAKAAIFLSAGFDASEWEGAGMQRHEVNV
PTEFYARLTRDVVRIAAEVDTAVEGRIVSVLEGGYSDRALCSGIMSHVCGLAGAGSTGNG
KAHDQYNPSWWSAAALEHLETTLLTPPPEPPKPPRNVATPTYCSPTQASTARSVAPRRSM
SGLHQHALMAANRPMSPMPARIPMPPAPEVPWAIAACELSKLLIPRDRQTDSCTHTDLNA
EATKARRERQLAQANTSASDAGTANSSDRPSTRMALRERKAKQAVPIKEEDTDEDRVDAV
SAGKTGVPRGGARATRSRRLSAASTIVPDSLDSSPPSHRYSATNAEDDGRPETSMSIRPE
SSMSVRPQGNPLVVNKTRGPAKSKNVLQAPRTQRQISTSTIESARSSNASLVSPASASLN
DQPSTGSNGDGVDTVTGGMKKVKITLITQAQKEARERERAAKENAGAISVVTSNLQENKL
RQQQPTQTPVATVQSPTESNTTSPAPSTQFYTPNSQGRNSFSSSEDMDATDKYPELFGHH
HLQDGDGDIDMEDFEIPALASTPMPSRTSFPLPLRPLQESSTPLENFIQYQPPAGKHQAS
VPAQTPTSPGQAMNRKDVPVFTATSAIPFSPQKTEPLQQSPAPSTPASLPSVIFAGQKQE
EKEEVVETPERN
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgtcctcctccgccgcgtttcacaacaggccatcatcctccgcgtccgtggca
tcctcccggtcttccgccactaatcccaggagagtttccggtgtgccagcaggtgctgga
tcagatgtccatacaactccaacctcagcgtcaaatctgcaacaaagacggctgtcacga
acggcgagcaaagggcaactggataagaacaatgcggacggggatttaacacagtccttg
aaccacctctccatttctctcgcgtccccgtcctccgtcacttcacagtctccttcgcct
aggaagagtcctcggtctgccaaccacccgccacctgcaatcagtccccttcgcccccag
ttctctacttcgactgctggatcgccaagcgggacgccctcccgtcccggtagcgccatg
cggaacgtatcctacggcgggccaccgtctcgctctcaaactcccgcacttcgccgcaaa
gcctccatgaactcgatccaggtcgcccacaacagcaatggccatggacttcgtcgatcc
agttcagtcaacctcacaccgtccgccgccaagaagtcacctttgaacgacatgtctcct
gatacgtccgagttcaaagtgccgcccaccccgcaatccatcgcgagtgaccacttcaag
gccgaacttgagattcatcacggacatgatccaaagctgtcggccgagaccattgttatt
ctgaacgatgcatgctatggacatcgctattctcgaccccggacatccaaggcaagcctg
agcaccatcgtcgaacgacccgagaggattaaggccagcgtcttgggagtgtcggccgcc
tatgtacgtctgggcgagcgacaccaagacggttcgttcccgattcatccggatcagcat
cccagcaacctcccttcggtaccttttctcatacaaaagacgactcgacgactggccatc
acatctccgacagtaaccaacgtacatggcacgaaatggatggaggaactcaagatcatg
tgcgataccgctgaagcgaagctggcgacgaatggcaaagaacttcaacgtccggatatg
gatcgtggacctgatgcggaagagcctccaaagttccatgaaggtgacctctatctgtgt
gcagaatcactagatgctatggaaggagctctcggcggtgtctgtgaggccgtcgatgcg
gtgtttaagcctgagggtccgaaaagggcttttgtagctattcgcccgcctggccaccac
tgctccgcctcgtatccttcgggcttttgttgggttaacaacgttcatgtgggcattatg
cacgcaattctgagccatggcttgacccatgccgccattatcgactttgacctccaccac
ggtgatggctcccagcaaattgcttggcagcacaactcaagaggcgtaaaggctgcaaag
aacgcagcgatgtggaagaagacctccattgggtacttcagccttcacgatatcaactcg
tatccttgcgagaccggcgacgacgaaaaagttatgaacgcgagtgtatgcatcgacaac
gctcatggacagaatgtgtggaatgtgcacctacagccctgggagacagaagaggatttc
tgggcactctacgagtccaagtacaccgtcttgcttgagaaggcgcgcagctaccttgtc
acacaggcggagcgcttgcgagcagcaggccaaaacgccaaggcagccatctttctttct
gctggtttcgatgccagcgaatgggagggcgctggaatgcagagacacgaagtcaacgtc
cccacagagttctatgctcgattaacccgagatgtagtacggattgcagcagaagtggat
acggctgtagagggccgaatcgtcagcgtactggagggaggatatagtgatcgggcgctt
tgctctggcatcatgagtcacgtttgcggccttgctggagctggttctactggaaatggc
aaagctcatgatcagtacaacccttcgtggtggtctgctgctgcgcttgaacatttggaa
accacactgttgacccccccacccgaaccaccaaagccccctcggaacgttgcgactcct
acctactgttcacctacacaggcctctacggcacggtctgtagcgccacggagaagtatg
tccggactccatcagcacgcactcatggcagccaacaggccgatgtcaccaatgccggcg
agaataccgatgccccctgctccagaggttccgtgggctattgctgcttgcgaactgagc
aagcttcttattccgcgcgaccgccaaacggatagctgtactcacacagatcttaatgct
gaggccaccaaggctcgtcgggagcgccagttagcccaggcgaatacttcggcgtccgat
gctggcactgcaaactcgtcggatcggccctctacaaggatggccttaagggagcgtaag
gccaagcaagcagtgcctatcaaggaggaggacacagacgaagaccgagtggacgctgtg
tccgcaggaaagactggtgtgccccgaggaggcgctcgtgctacacgtagtcgacgcctt
agtgctgcttcgaccatcgtcccagacagccttgactcgtctcctccaagccacagatac
tcagccacaaatgcggaagatgatggaagaccggaaacatccatgagcatcaggcccgag
tcttcaatgagtgtcagaccgcaggggaaccctcttgtggtcaataagacgcgggggcca
gcaaagagcaagaatgttctgcaagcaccgaggacacagaggcagatttcaacttcaacc
atcgaatcagcaaggagctccaacgcatccctagtatcaccagcttcggcttcccttaac
gatcagccatcaactggtagcaatggcgacggcgtagatacagtgaccggcgggatgaag
aaggttaagattactcttatcacacaagcccagaaagaggctcgcgagcgggagcgtgct
gcgaaagaaaacgccggtgcgatttctgtcgttacatccaacctacaggaaaacaaactt
cgtcaacaacagcctacgcagacacccgttgccacagtccaatctcccaccgaaagcaac
accacctctcccgcgccatccacgcagttctacactcccaactcacaaggtcggaactca
ttttcctcctccgaagacatggacgccacggacaagtatccggagctttttgggcaccat
cacctccaagacggggatggtgacatcgacatggaagatttcgaaatacccgctcttgca
tccacgcccatgcctagtcgtacttcattccctctaccgttgaggcctcttcaagagtct
tccactcccttggaaaacttcatacagtaccagcctcctgctggcaagcaccaggcctct
gtaccagcacagacaccaactagtcccggacaagctatgaacagaaaggacgtgcccgtg
tttactgccacctcagccattcccttttcgccccagaagacggagccattgcagcagtct
ccggcgccgtctacgcctgcttcattgccaagtgtgatctttgctggacagaagcaggaa
gagaaggaagaggttgtggagacgccagagaggaattga

DBGET integrated database retrieval system