KEGG   Neurospora crassa: NCU07550Help
Entry
NCU07550          CDS       T01034                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00010  Glycolysis / Gluconeogenesis
ncr00051  Fructose and mannose metabolism
ncr00562  Inositol phosphate metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
ncr01230  Biosynthesis of amino acids
Module
ncr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncr_M00002  Glycolysis, core module involving three-carbon compounds
ncr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU07550
   00051 Fructose and mannose metabolism
    NCU07550
   00562 Inositol phosphate metabolism
    NCU07550
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCU07550
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCU07550
  Exosomal proteins of bladder cancer cells
   NCU07550
  Exosomal proteins of melanoma cells
   NCU07550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 3875201
NCBI-ProteinID: XP_959063
UniProt: Q7S2Z9
Position
Linkage Group III; III
AA seq 248 aa AA seqDB search
MARKFFVGGNFKMNGTRKDLKAIVDNLNNAQLDPNAEVVIAPPALYLDFVKQNLQKPNVE
VAAQNVFNKPNGAFTGEISATQLLDLGVKWVILGHSERRNELGESDEFIASKTKYALDNG
ISVIWCCGESKDTRQAGETIKFVENQLAALAKEINDWKNVVIAYEPIWAIGTGLVATKEQ
AQEVHAAIRSWLKQNVSDKVAEETRILYGGSVNAKNCKDLAKEQDIDGFLVGGASLKPEF
VDIINANL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggcggcaacttcaagatgaacgggacccgtaaggatctc
aaggccatcgttgacaaccttaacaacgcccaattggaccctaacgccgaggtcgtgatc
gcccctcccgctctctaccttgacttcgtcaagcagaacctccagaagcccaacgttgag
gttgccgctcagaacgtcttcaacaagcccaacggcgccttcaccggcgagatcagcgcc
acgcagctcctggatctcggcgtcaagtgggtcattctcggccactctgagcgccgcaac
gagctcggcgagtcggacgagttcattgcctccaagaccaagtacgccctcgacaacggc
atctcggtcatctggtgctgcggcgagtccaaggacacgcgccaggccggcgagaccatc
aagttcgtcgagaaccagctcgccgctctcgccaaggagatcaacgactggaagaacgtc
gttatcgcgtacgagcccatctgggccattggcaccggcctcgtcgccaccaaggagcag
gcccaggaggtgcacgccgccatccgcagctggctcaagcagaacgtcagcgacaaggtt
gctgaggagacccgcatcctctacggtggctctgtcaacgccaagaactgcaaggacctt
gccaaggagcaggacattgacggtttccttgttggcggtgccagcttgaagcccgagttc
gtggacatcatcaacgccaacctgtaa

DBGET integrated database retrieval system