KEGG   Neurospora crassa: NCU07717Help
Entry
NCU07717          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ncr  Neurospora crassa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCU07717
   03420 Nucleotide excision repair
    NCU07717
   03430 Mismatch repair
    NCU07717
   03440 Homologous recombination
    NCU07717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 284 aa AA seqDB search
MAGYGGYGGGDGGGFMSGSQQGGSQAGGSKYADESLRPVTIKQLLDWEETFPGAELAIDG
HPVTQVTIVGQVRSVKPQPTNITYRIDDGTGAIDVKKWVDSEAQGGEDGGSGAGTIAPDA
FVRVWGRLKSLGGKKHVSANFIRQIEDFNEVNYHLLEATYVHLFFTKGAPGSGGGAKQEG
GGGDNMFVDQGYGAGGGDVAMGGAGPGGGNSAMQARLATCSRNAQIMCNFINNSPGGTEG
VNLHVIAQGTRMSVRDITNAADELLGQGIIYTTQDDETWAILDY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctacggcggatatggtggtggcgatggcggtggcttcatgtccggatcccaa
caaggtggtagtcaagccggtggctccaagtacgccgacgagtccctccgccccgtaacc
ataaaacagcttctcgattgggaagagaccttccccggcgccgagcttgccatcgacggc
cacccagtaacccaagtgaccattgtgggccaagtgcgctcggtcaagccgcaaccgact
aacatcacgtaccggattgatgacggcacgggagccatcgacgtcaagaagtgggtcgat
tcggaagcgcaaggcggcgaggacggtggcagcggtgccggcacgatcgcgcccgacgcc
ttcgtgcgcgtgtggggccgtctcaagtctctcggcggcaagaaacacgtaagcgccaac
ttcatacgccagattgaggatttcaacgaggtcaactaccacctgcttgaggcgacgtat
gtgcatctgttctttaccaagggagctcctggtagtggtggtggtgccaaacaagaaggt
ggcggaggggacaacatgtttgtggatcagggatacggagcaggaggcggcgatgttgct
atgggcggcgctggccccggtggaggaaacagtgcgatgcaggcgagattggcgacgtgc
tcaaggaacgcgcagatcatgtgcaatttcatcaataactcgcctggcgggacggagggt
gtcaatttgcatgtgattgcgcagggcacaagaatgtcggttagagatatcacaaatgcg
gcggatgagttgctggggcagggtattatttacactacgcaggatgatgagacgtgggcc
attctggattattag

DBGET integrated database retrieval system