KEGG   Neurospora crassa: NCU07717Help
Entry
NCU07717          CDS       T01034                                 

Gene name
rpa-2
Definition
(RefSeq) replication protein A-2
  KO
K10739  
replication factor A2
Organism
ncr  Neurospora crassa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCU07717 (rpa-2)
   03420 Nucleotide excision repair
    NCU07717 (rpa-2)
   03430 Mismatch repair
    NCU07717 (rpa-2)
   03440 Homologous recombination
    NCU07717 (rpa-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group IV; IV
AA seq 284 aa AA seqDB search
MAGYGGYGGGDGGGFMSGSQQGGSQAGGSKYADESLRPVTIKQLLDWEETFPGAELAIDG
HPVTQVTIVGQVRSVKPQPTNITYRIDDGTGAIDVKKWVDSEAQGGEDGGSGAGTIAPDA
FVRVWGRLKSLGGKKHVSANFIRQIEDFNEVNYHLLEATYVHLFFTKGAPGSGGGAKQEG
GGGDNMFVDQGYGAGGGDVAMGGAGPGGGNSAMQARLATCSRNAQIMCNFINNSPGGTEG
VNLHVIAQGTRMSVRDITNAADELLGQGIIYTTQDDETWAILDY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctacggcggatatggtggtggcgatggcggtggcttcatgtccggatcccaa
caaggtggtagtcaagccggtggctccaagtacgccgacgagtccctccgccccgtaacc
ataaaacagcttctcgattgggaagagaccttccccggcgccgagcttgccatcgacggc
cacccagtaacccaagtgaccattgtgggccaagtgcgctcggtcaagccgcaaccgact
aacatcacgtaccggattgatgacggcacgggagccatcgacgtcaagaagtgggtcgat
tcggaagcgcaaggcggcgaggacggtggcagcggtgccggcacgatcgcgcccgacgcc
ttcgtgcgcgtgtggggccgtctcaagtctctcggcggcaagaaacacgtaagcgccaac
ttcatacgccagattgaggatttcaacgaggtcaactaccacctgcttgaggcgacgtat
gtgcatctgttctttaccaagggagctcctggtagtggtggtggtgccaaacaagaaggt
ggcggaggggacaacatgtttgtggatcagggatacggagcaggaggcggcgatgttgct
atgggcggcgctggccccggtggaggaaacagtgcgatgcaggcgagattggcgacgtgc
tcaaggaacgcgcagatcatgtgcaatttcatcaataactcgcctggcgggacggagggt
gtcaatttgcatgtgattgcgcagggcacaagaatgtcggttagagatatcacaaatgcg
gcggatgagttgctggggcagggtattatttacactacgcaggatgatgagacgtgggcc
attctggattattag

DBGET integrated database retrieval system