KEGG   Neurospora crassa: NCU07774Help
Entry
NCU07774          CDS       T01034                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCU07774
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NCU07774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 182 aa AA seqDB search
MKGAVRTLLECIGEDPDREGLLATPERYAKAMLFLTKGYQENVRDIVNGAIFQEGHNEMV
IVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAELFARRLQIQERLTKEVA
NAIMEILKPQGVAVVMESSHLCMVMRGVQKTTSSTITSCVLGCFESREKTRLEFLSLIGV
NR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccgtccggaccctgctcgaatgcatcggcgaggacccggaccgcgaaggt
ctcctcgccacgcccgagcgctacgccaaggccatgctcttcctgaccaagggctaccag
gagaatgtgcgcgacattgtcaacggggccatcttccaggagggccacaacgagatggtg
attgtcaaggacattgaggtcttttccatgtgcgagcaccacctggttcccttcacgggc
aagatgcatatcgggtacatccccagcaacgcggtgattggcattagcaagctgccgcgg
attgcggagctgtttgcgcgccggctgcagatccaggagcggttgaccaaggaggtggcg
aatgccattatggaaatcctcaagccgcagggtgtcgcggtcgtcatggagagcagccat
ttgtgcatggtcatgagaggcgttcagaagaccacgagcagtaccattaccagctgtgtg
ttggggtgctttgagtcgagggagaagacgaggctcgagttcttgagcttgattggcgtc
aaccgctaa

DBGET integrated database retrieval system