KEGG   Neurospora crassa: NCU07919Help
Entry
NCU07919          CDS       T01034                                 

Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ncr  Neurospora crassa
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCU07919
Enzymes [BR:ncr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     NCU07919
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCU07919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Linkage Group IV; IV
AA seq 262 aa AA seqDB search
METSELDRSKIYKSWEVDGKFHSDGREVTLLGYVYSRPDIDQLRGSPQKVLEAIDDFARS
VTGLINIGEAKGAVVTKLIADCKPATILELGGYVGYSAILFGDALRKAGGKQYHSVEKSP
LFAAVAASLVDLAGLRDVVRITVGTGAEGIQRLYDSGVLKSQLSMAFFDHHKPSYTSDLK
RCERLGLVGPGTVLVADNMILPGNPPYAEWVRASVAEKQELDKNAEEKGSPNLQYKSRAI
KSWEPSGHEDALEITECVGIEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggagacttcagaactcgatcgctcaaagatctacaagagctgggaggtggatggcaag
tttcatagtgatggccgcgaagttaccctacttgggtatgtctacagccgtccggacatt
gaccagctgcgcgggagcccacaaaaggttctggaggccatcgacgactttgcccgctct
gtgaccggcttgatcaacattggcgaggcaaaaggtgctgtggtcacgaaactcattgcc
gattgcaaaccagccaccatcctcgagctgggtggctatgtcggctactccgccatcttg
tttggcgatgcactacgaaaggctggcggaaagcaataccatagtgtcgagaaaagcccc
ctttttgctgctgttgccgcaagccttgtcgacttggctggcctcagggatgtcgtcaga
atcactgtcggcaccggcgccgagggcatccaacgtctctacgattcaggcgtgctcaag
tctcagctttccatggccttctttgaccatcacaagccaagctataccagtgatctcaag
cgatgtgagagactcggccttgttggcccaggcaccgtcttggttgctgacaacatgatt
ctaccgggaaacccgccatatgctgagtgggtcagagccagtgtggccgagaagcaggag
cttgacaagaatgccgaagaaaagggaagtccgaatctgcaatacaagagcagagctatc
aagagctgggagccgagtggccatgaggatgctctggagattactgagtgcgtgggtatc
gaagcttga

DBGET integrated database retrieval system