KEGG   Neurospora crassa: NCU07919Help
Entry
NCU07919          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ncr  Neurospora crassa
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCU07919
Enzymes [BR:ncr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     NCU07919
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCU07919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 246 aa AA seqDB search
METSELDRSKIYKSWEVDGNRPDIDQLRGSPQKVLEAIDDFARSVTGLINIGEAKGAVVT
KLIADCKPATILELGGYVGYSAILFGDALRKAGGKQYHSVEKSPLFAAVAASLVDLAGLR
DVVRITVGTGAEGIQRLYDSGVLKSQLSMAFFDHHKPSYTSDLKRCERLGLVGPGTVLVA
DNMILPGNPPYAEWVRASVAEKQELDKNAEEKGSPNLQYKSRAIKSWEPSGHEDALEITE
CVGIEA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggagacttcagaactcgatcgctcaaagatctacaagagctgggaggtggatggcaac
cgtccggacattgaccagctgcgcgggagcccacaaaaggttctggaggccatcgacgac
tttgcccgctctgtgaccggcttgatcaacattggcgaggcaaaaggtgctgtggtcacg
aaactcattgccgattgcaaaccagccaccatcctcgagctgggtggctatgtcggctac
tccgccatcttgtttggcgatgcactacgaaaggctggcggaaagcaataccatagtgtc
gagaaaagccccctttttgctgctgttgccgcaagccttgtcgacttggctggcctcagg
gatgtcgtcagaatcactgtcggcaccggcgccgagggcatccaacgtctctacgattca
ggcgtgctcaagtctcagctttccatggccttctttgaccatcacaagccaagctatacc
agtgatctcaagcgatgtgagagactcggccttgttggcccaggcaccgtcttggttgct
gacaacatgattctaccgggaaacccgccatatgctgagtgggtcagagccagtgtggcc
gagaagcaggagcttgacaagaatgccgaagaaaagggaagtccgaatctgcaatacaag
agcagagctatcaagagctgggagccgagtggccatgaggatgctctggagattactgag
tgcgtgggtatcgaagcttga

DBGET integrated database retrieval system