KEGG   Neurospora crassa: NCU07954Help
Entry
NCU07954          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ncr  Neurospora crassa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCU07954
Translation factors [BR:ncr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NCU07954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 274 aa AA seqDB search
MSGKKWDEEEEESSAPNSPVLAPGRRRFDDEEGNESDVLDSWDAAEDSEVEREKAKKAAE
AKAKAEAEAAANKKSKAQRIAERQAERARQLAEDSDAEEETEAERRERLRREQKESDLKH
AEDLFAGIGISNDRKVVSKGTIVQIDPKDPNNTIDISTLALFNPTTKTQFETLRTTLGPM
IGKLSPKPHYTLFLQEFSKQLAKDLKSDEIKKIASTLTALSNEKLKEEKAAEKGGKKSKA
AKTKTSLAGVGRGGAIAEAHDTYDDDAFGDDDFM
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaagaagtgggacgaggaagaggaggagtcttccgcccccaactcgcctgtc
cttgcccccggccgccgccgcttcgacgatgaggagggaaacgagagcgacgttctcgac
tcgtgggatgccgccgaggactccgaggtagagcgcgagaaggcgaagaaggccgccgag
gccaaggccaaggctgaggccgaagccgccgccaacaagaagtccaaggcgcagcgcatc
gccgagcgtcaggccgagcgcgcccgccagctggctgaggattcggacgcggaggaggag
accgaggccgagcgccgcgagcgcctccgccgcgagcagaaggagtccgatcttaaacac
gctgaggacctgtttgccggcatcggcatcagcaacgaccgcaaggtcgtcagcaagggc
accattgtccagatcgaccccaaggaccccaacaacaccatcgacatctcgaccttggcc
ttgttcaaccctaccaccaagacccagtttgagaccctccgcaccactcttggccccatg
atcggcaagctctcgcccaagccgcactacaccctcttcctccaggagttctccaagcag
ctcgccaaggacctcaagagcgacgagatcaagaagattgctagcaccttgactgctctc
agcaacgagaagctcaaggaggagaaggctgccgaaaagggtggcaagaagagcaaggct
gccaagacaaagacctcgctcgctggtgttggtcgtggtggtgccattgctgaggcccac
gacacttatgatgatgatgctttcggagatgatgacttcatgtga

DBGET integrated database retrieval system