KEGG   Neurospora crassa: NCU08153Help
Entry
NCU08153          CDS       T01034                                 

Definition
similar to alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCU08153
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCU08153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII
AA seq 668 aa AA seqDB search
MEKDMYKQDAPCCHHGMQLFYFPVNQVGASLDTPFRVTTMKQTTGILLFATAASAFYAGN
INYLSPSLRHPSLGISIPKVAARTYESLPWKPEQLNFTHGVASGDPYDDSVILWTRAAPT
MDNDHSNTTVSGTTGLFSHETEEFVFFSKSKVCVDWKIATDEKFEKVADEGRVWTSSDID
FTVKVEAKKLCPFTTYYYQFNICDSYNNSPVGRTKTLPARGKKVPSGIKLAVYSCSNYPQ
GFFNVFGNTVRKDSVDFIVFLGDYIYEFQNGQYGWGDALGRIPQPDRVTYTLYDYRRRIA
TYRTDLDLVANHMKFPWIQVWDDHEVADNTWRDGSSFLQNNEDSFISDGGVSTDSRKANA
VRAYFEWMPIRQVDMDDGLRIWRNFEFGDLFDLIMLDTRQYDRSITNIYTNTGYIKDISD
DTSRSLMGPRQEAWFYRTLKESSQRGTKWRLIGNQIIFSQLLVSKDRNLPYDYDAWDGYV
ANRNRTLATLYENSITNNIMLAGDSHASWASDLVWLDKPIELGEYDPITGRGAIGVEFAV
SAVSSPSPLGQNVTMEETETYTSLLTNFNKELQWTDLYYRGYTELCVGYEGVTARFYGAP
DIRTRNGFEVSLANFTVKDGENRLQRYGEEMVASVDGKVEFGSLQRGKTVTANLTYDTEE
KRWFVFGE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggatatgtataaacaggatgctccatgctgtcatcatggaatgcaactgttc
tacttcccagtcaaccaagtgggagcgtcacttgatactccttttcgagtaacaacgatg
aagcagacaacaggcattctgttgttcgctacggcagcttcggctttctacgcgggcaat
atcaactacttgtcgccatccctccgtcacccatccctgggtatttcaattcccaaggtc
gcggcaaggacgtatgaaagcttaccatggaagcctgagcagctcaactttacacacggc
gttgcttcaggagatccgtacgatgacagcgtcattctttggacacgggcggcaccaacg
atggacaatgaccactctaataccaccgtcagcggaaccactgggctgttcagccatgag
acagaagaatttgtgttcttcagcaagtccaaagtgtgtgttgactggaagattgccacg
gatgaaaagtttgagaaagtagccgatgaaggacgtgtgtggacaagttcggacattgac
tttactgtcaaggtcgaggcgaagaaactctgcccgttcactacgtactactatcagttt
aatatttgcgattcctacaataactcgccggtcggacggactaagacactcccagcaagg
ggcaagaaagttccttctggtatcaaacttgccgtgtactcgtgcagcaactatccccag
ggcttcttcaacgtgtttggaaacacggtgaggaaggattcggtcgactttattgtcttt
ttgggtgactacatctacgaattccagaacggacagtatggctggggtgatgctcttggt
cgcatcccgcagcccgaccgggtaacatataccttgtatgattaccgaaggagaattgcg
acgtaccgtaccgacttggacctggttgccaaccacatgaagtttccttggattcaggtg
tgggatgatcacgaggtggcggacaatacgtggcgtgatggaagctcctttctgcagaac
aacgaggactcgtttatcagtgacggcggtgtgtcgacagatagccgcaaggcaaacgcc
gttcgggcttactttgaatggatgcccatccgtcaggtagacatggatgatggcctgcgc
atctggagaaatttcgaattcggcgacctcttcgacctcatcatgttggacacgcggcaa
tatgaccggtccatcaccaacatatacactaacacaggatacatcaaagacatctccgac
gacacctcccgctctctcatgggtccccgacaagaagcctggttctaccgcacgctcaaa
gaatcctcccagcgcggcaccaagtggcgactcatcggcaaccaaatcatcttcagccag
ctgctcgtcagcaaggacaggaacctgccctacgactacgacgcctgggacggctacgtg
gccaaccgcaaccgcaccttggctacgctctacgagaacagcattaccaacaacattatg
ctagcaggcgactcgcacgcgtcatgggcatctgatctcgtgtggctcgacaagccaatt
gaactaggggaatacgaccccatcacgggccgcggggcaatcggcgttgagttcgccgtc
agcgcggtctcgagccctagtccgctgggacagaatgtcacgatggaggagacggagacg
tacacgagtctgttgacgaactttaacaaggaactgcagtggacggatctgtattatagg
gggtacactgagttgtgtgtcgggtatgaaggggtgactgctcggttctacggggcgccg
gatatcaggacgaggaacgggtttgaggtgtctttggcgaacttcacggtcaaggatggg
gagaatagactgcagagatatggagaggagatggtggcgagcgtggatgggaaggtggag
tttggaagtttgcagagggggaagacggtgacggctaatttgacgtatgatacggaggag
aagaggtggtttgtgtttggggagtag

DBGET integrated database retrieval system