KEGG   Neurospora crassa: NCU08189Help
Entry
NCU08189          CDS       T01034                                 

Definition
similar to endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 384 aa AA seqDB search
MQTKSLLSFLALASVPLASAGNGNGNGHDKGSGKSCSHKGLDWYAKKAGLKYFGAATDSP
GQRERAGLESAYPKYDEIMWKSGEFGQTTPTNGQKWLFTEPTQGTFNFTEGDIVVSLAHQ
HHKLLRCHALVWHSQLAPWVEAGTWTKDELRSVIVSHITNVMTHYKGQCYAWDVVNEAFN
EDGTYRESVFSTVLGGDEFIQLAFETASKLDPQAKLYYNDYNLESPSAKTEAVRKLVRQL
QNKKIKIDGVGLQAHLTAESRPTLDEHVAAIKGFAELGVEVALTELDVRLEMPANATNLA
QQKEAYKNAVGACVQVDGCIGVTIWDFYDPFSWVPAVFPGEGAALLWFDDFSRHPAYEGV
VEALTNKTQGYNGKGPRGVKRWVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccaagtccctcctctccttcctcgccttggcctccgtgcctctggcttctgcc
ggcaacggcaacggcaacggccacgacaaaggttccggaaagtcttgctcccacaagggt
ctagactggtacgccaaaaaggccggcctcaagtacttcggcgcggccaccgactcgccc
ggccagcgcgagcgtgcaggtttggagtctgcttaccccaagtacgacgagatcatgtgg
aagtctggagagttcgggcagacgacgcctactaatgggcaaaagtggctcttcaccgaa
cccacccaaggcaccttcaacttcaccgaaggcgatatcgtcgtctccctcgcgcaccag
caccacaagctcttgcgatgccacgccctagtctggcactcgcagctcgctccctgggta
gaggccggtacctggaccaaagacgagctccgctctgttattgtctcgcacatcaccaac
gtcatgacccactacaagggccagtgctacgcctgggacgtggtcaacgaagccttcaac
gaggacgggacctatcgcgaatcggtgttttccaccgttttaggtggggatgagtttatc
cagttggcttttgagacggcgagcaaactggatccccaagcaaagttgtattataatgat
tataacttggagagcccgagcgccaagacggaggcggtcaggaagctggtgaggcagttg
cagaacaagaaaatcaagattgatggcgtgggactccaggcgcatttgacggcggagagc
aggccgacgctggatgagcatgtcgctgccattaaggggttcgcggagttgggcgtggag
gtggcgttgacggagttggatgtgaggttggagatgccggcgaatgcgacgaatttggcg
cagcagaaggaggcgtataagaatgccgtcggagcttgcgtccaagtcgacggatgcatc
ggtgttaccatttgggatttctacgaccctttcagctgggtccctgccgtctttcccggt
gaaggtgctgcccttctctggttcgatgactttagcagacaccctgcttacgagggtgtt
gtggaggctctgaccaacaagacccaagggtataatggaaagggtcctcgtggtgttaag
cgttgggttgcctaa

DBGET integrated database retrieval system