KEGG   Neurospora crassa: NCU08276Help
Entry
NCU08276          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ncr  Neurospora crassa
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ncr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 1454 aa AA seqDB search
MESLSNLGNAMSSVLSETTSTTATAILADPTEALSSVVALASDAVSKATSDVVPEHTPTS
WFTIILWLLHRISSVLYFVIKLTTITTPTFLFNIFSTSLTVTMNATTLAIKIFGYLERPV
FHELTRSMQTRKLIAGETLNLEEEQGFCLVVDGMVEIFVKSARDGRRSSSGPSFESDDEE
GFAPGRQRYQLLTEVRNGAPMSSLFSIMSLFTEDIQMHDTDDDDSPDPTPSAPGTAMPGY
PMNANFQQSNDTLPSIPGTPLSDNHVMQRGMASAESLTMSPLAHDSSRIPSLSLVNTRPA
VPRRPVPKRLNTTSAHPDIIARATVDTTIAIIPASAFRRLIKIYPKATAHIVHVILSRFQ
RVTLATAYNYLGLSGEVLQMERNILKHTVRQLPNHLRGDALDRLKEKFKRERERIGEKEV
EKGIALHNAHAARRRRSAASLRKEVALQAYSKRRQSIVTATPAFGTRRERPSPDMPSPGD
LLTNTQQLKSGPASQLDLARDATSPRPQRNLSPFSTPRNAHVSLDTREALDEDDMFRESV
LECMFRAIGLTGNGSVNPDSTQASPRFVPTDQRRSRGGPGHTAFGFMDAFDPFDNDTESV
TSCGFSSSSPVPNPQLLAHDMKDEVEIVFFPKGSVLVEQGERNPGLYYVIDGFLDICVPG
DDSSHDLLQSSAKVDHGHDSATGADAFGANSSRFPEPNMNNNFGAEQKKGKQGRRSVALI
KPGGLAGYVGTISSYRSFIDVVARTDVCVGFLPLASIDRIVDRYPIVMLTMAKRLTELLP
RLLLHIDFALEWVQVNSGQVLFREGDESEAIYLVLNGRLRLVEDQKDGGMNVKAEFGQGE
SIGELEVLTESARTGTLHAIRETELVKFPRTLFNSLAQEHPNITIKISKIIAARMRAFID
DPSRMGLKDNVVRSYKSSSTLNLRTVAILPVTAGVPVVEFGNRLMNALSQVGPPNGATCL
NQAAILNHLGKLAFNRMGKLKLSQYLADLEEKYGLVVYVADTNVNTPWTQTCITQADCLL
FVGLADSSPEIGEYERFMLGMKSTARKILVLVHQERYSNPGLTRQWLKNRMWINGGHFHV
QMAYTSNTVPIHPPTKRFGPSLKQRVQILQAEIQKYTSRKVRHVPFYSPDAPFKGDFHRL
ARRLCGKSVGLVLGGGGARGIAHVGIIRAMEEAGIPIDMVGGTSIGAFIGGLYARHADVV
PIFGLAKKFAGRMASMWRFAFDLTYPSASYTTGHEFNRGIFKTFGKTQIEDFWLEYYCNT
TNISKSRVEFHTSGYAWRYIRASMSLAGLLPPLCDEGSMLLDGGYIDNLTVSRMKSLGSD
VIFAVDVGSLDDNTPQAFGDSLSGVWAFFNRWNPFSSVPNPPTLAEIQARLAYVSSVGEL
ERAKTMPGCIYMRPPIDDYGTLDFGKFDEIYGVGYKYGQEFLQKLREQGVLPLVEETEAK
KALRRTMAPRRASI
NT seq 4365 nt NT seq  +upstreamnt  +downstreamnt
atggagtctcttagcaacctcggcaacgccatgagctcggtgctttccgagacaacgtcc
acgactgcgacggcaatcctcgccgatcctacagaagccctctcgtctgtcgtcgctctc
gccagcgatgcggtctcgaaagctactagcgatgtggttcccgaacacaccccgacttca
tggttcaccatcatcctctggctgttgcaccgcatctcgagtgtgctatactttgtcatc
aagctgaccaccatcactacacccacctttctgttcaacatcttttcgactagtctgacg
gtgaccatgaacgccactacgctcgccatcaaaatctttggttatctggaaaggccggtt
ttccatgaactgacccgcagcatgcaaacgaggaagctgatcgctggcgaaaccctcaac
ctcgaagaagagcaaggattctgtcttgtggtcgacggtatggtggagatctttgttaaa
tccgccagagatggtcgacgctcaagcagtggcccttcgttcgagagcgacgatgaggaa
ggctttgctccgggtcgccagcgctaccagcttctgaccgaagtgcggaacggtgccccc
atgtcatcactgttctctatcatgtcactcttcactgaagatatccaaatgcatgacacc
gacgacgacgacagccccgacccaacgccttccgctcctggcaccgctatgcctggttat
cctatgaacgccaacttccagcagtcgaacgataccctcccgtccatcccaggtacccca
ttgtccgacaaccacgttatgcaacgtgggatggcttcggctgagtctctaacaatgtct
cccctagctcatgattcttcgaggataccatcactttctctcgtgaacactcgtcctgct
gtaccccgccggccggtaccgaagaggctcaataccacttcagcccatccagatattatt
gcgagagcgacagtggacactaccatagccattatccccgccagcgccttcaggcgtctg
atcaagatatatcccaaggccactgcgcacatcgttcatgtcatcctttcgaggtttcaa
agagtgacacttgccactgcttacaactaccttggcttgagcggcgaagtattgcagatg
gagcgcaacatcttgaagcatacagttcggcaactccctaatcatctcagaggagacgct
ttggatagactcaaggaaaagttcaagcgggaaagggaaagaattggagagaaggaggtc
gaaaagggcattgctcttcacaatgcgcatgccgcccgccgacgtcgttcggctgcctcc
cttcggaaagaagtggcattgcaggcatattcgaaaaggcggcagagcatcgtcacggcg
acccctgcattcggaacacgtcgagaacgcccatcgcccgacatgcctagccccggcgac
ttgctcacgaatacgcaacagttgaagtctgggccggcatcgcagcttgatctagcgcga
gacgctacatctcctcgaccacagcgaaatctcagtcccttctctactcctcgaaacgca
catgtctctcttgacacgagggaagcccttgatgaagacgacatgttccgagagtcggtg
ctcgaatgcatgttcagggccattggcctgaccggtaacggaagtgtcaatccggattcg
acgcaagcttccccaagatttgttcctacggaccagcgacgttcgaggggtggtcccggc
cacactgcttttggcttcatggatgccttcgacccgttcgacaacgacacggagtcagtt
acctcttgtggatttagctcatcgtcaccagttcccaatcctcaactactcgcacacgat
atgaaggacgaggttgagatcgtcttctttcctaagggctctgtcttggtggagcaaggt
gagagaaatcctggtctctattatgttattgatggtttcctcgacatttgtgttccgggc
gacgattcatcacacgacctcctccagtcctcagccaaggtagaccatggccatgactca
gcaactggtgccgacgcctttggggccaattcgtcacgctttcctgaaccgaacatgaac
aacaactttggtgctgagcagaagaaaggcaaacaaggtcgaaggagcgtggctctgatc
aaaccgggtggacttgctggttatgttggtaccatttcctcctacagatcgtttatcgat
gttgttgcgagaacggatgtctgtgtcggctttcttccacttgcctctattgacaggatc
gttgaccgttatcccatcgttatgcttactatggccaagcggcttacggagttactgccg
cgtctgcttctgcacatcgactttgccctcgagtgggtgcaggtcaactctggccaggtt
ttgttccgcgaaggtgatgagagcgaagcaatttaccttgtcctcaatggccggttaaga
ctggttgaagatcaaaaagatggggggatgaacgtcaaagctgaattcggccagggagag
agtatcggagagctggaagtgctgaccgaatccgcacgtaccggaactctacacgcaatt
cgcgaaactgaactggtcaaatttcctcgcacgcttttcaacagtttagcccaggaacat
cccaacatcactatcaaaatttccaaaattatcgcagcgcgaatgagggcctttatcgat
gatccttcacgcatgggactcaaagataacgtggttcggagctataagagctcttcgacg
ctaaacctgagaaccgtggcaatcttacctgtcaccgcgggcgttcctgttgtcgagttt
ggcaataggttaatgaacgccttgtcacaggttgggcctcctaacggcgcaacttgtcta
aatcaagcagcgatcttgaatcacctcgggaaactcgcattcaacaggatgggaaagctc
aaactgtcccagtacctcgcagatctagaagagaaatacggactcgttgtctacgtagct
gacacgaacgtcaacacgccatggacccagacgtgcattacgcaagctgattgcttattg
tttgtcggtcttgcggacagctcccctgaaatcggagagtatgagcggttcatgcttgga
atgaaatcaacggcccgaaaaatcctcgtcctcgttcaccaagagcgctactccaaccct
ggtctgacgaggcagtggctgaagaaccgaatgtggatcaatggaggccacttccatgtg
caaatggcatatacctccaacactgtgcctatccatccgcccacgaaacggttcgggcca
agcctcaagcagcgggttcagatcttgcaggcagagattcagaagtacacctccaggaaa
gttcgccatgttcccttctactctcccgatgctccgttcaagggagacttccatcggttg
gcgaggcggctgtgcggcaagtccgtgggtctggtcctaggtggtggtggcgccagaggc
attgcgcatgttggcatcatcagagcgatggaagaggctggaatccccattgacatggtc
ggagggacgtcaattggagccttcatcggcgggttgtatgccaggcatgcagatgttgtt
cccatcttcggtttagccaagaagttcgctggacgtatggccagcatgtggaggttcgct
tttgacctgacatatccgtccgcctcctacacaaccggccacgagttcaaccgcggcatc
ttcaagacctttggaaaaacgcagattgaagatttctggctggaatactactgcaatacc
actaacatcagcaaaagccgagtcgagttccacaccagtggttacgcatggcgctacatc
cgagcgtccatgtccctggcgggtttacttccacctctgtgtgacgaaggcagcatgctt
ttggacggcggctacatcgacaatttgactgtatcccgtatgaaatctctcggttcggac
gtcatttttgctgttgacgtcggctcgcttgatgataatacgcctcaggcctttggcgac
tctctgtctggtgtatgggcattcttcaaccgctggaacccattctcatcggtacccaac
ccgcccacgctggcagagatccaggcccgccttgcgtatgtgtcgagtgtcggtgagcta
gagagggcaaagacgatgcccggatgcatatacatgcggcccccgatcgacgactacgga
acgctggattttggcaaatttgacgagatctatggggtcgggtacaaatatggccaggag
ttcctccagaagttgagggagcagggtgtattgcctctggttgaggagacagaggcgaag
aaagcgttgaggagaacgatggcgccgaggcgcgcgagtatatag

DBGET integrated database retrieval system