KEGG   Neurospora crassa: NCU08276Help
Entry
NCU08276          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ncr  Neurospora crassa
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCU08276
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCU08276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group IV; IV
AA seq 1515 aa AA seqDB search
MESLSNLGNAMSSVLSETTSTTATAILADPTEALSSVVALASDAVSKATSDVVPEHTPTS
WFTIILWLLHRISSVLYFVIKLTTITTPTFLFNIFSTSLTVTMNATTLVLIMLFMMAGVT
WVVRYRYLNMYSRLPPEPQRKEPAVDLFPETQEEGVKSGLASYFDEFLSAIKIFGYLERP
VFHELTRSMQTRKLIAGETLNLEEEQGFCLVVDGMVEIFVKSARDGRRSSSGPSFESDDE
EGFAPGRQRYQLLTEVRNGAPMSSLFSIMSLFTEDIQMHDTDDDDSPDPTPSAPGTAMPG
YPMNANFQQSNDTLPSIPGTPLSDNHVMQRGMASAESLTMSPLAHDSSRIPSLSLVNTRP
AVPRRPVPKRLNTTSAHPDIIARATVDTTIAIIPASAFRRLIKIYPKATAHIVHVILSRF
QRVTLATAYNYLGLSGEVLQMERNILKHTVRQLPNHLRGDALDRLKEKFKRERERIGEKE
VEKGIALHNAHAARRRRSAASLRKEVALQAYSKRRQSIVTATPAFGTRRERPSPDMPSPG
DLLTNTQQLKSGPASQLDLARDATSPRPQRNLSPFSTPRNAHVSLDTREALDEDDMFRES
VLECMFRAIGLTGNGSVNPDSTQASPRFVPTDQRRSRGGPGHTAFGFMDAFDPFDNDTES
VTSCGFSSSSPVPNPQLLAHDMKDEVEIVFFPKGSVLVEQGERNPGLYYVIDGFLDICVP
GDDSSHDLLQSSAKVDHGHDSATGADAFGANSSRFPEPNMNNNFGAEQKKGKQGRRSVAL
IKPGGLAGYVGTISSYRSFIDVVARTDVCVGFLPLASIDRIVDRYPIVMLTMAKRLTELL
PRLLLHIDFALEWVQVNSGQVLFREGDESEAIYLVLNGRLRLVEDQKDGGMNVKAEFGQG
ESIGELEVLTESARTGTLHAIRETELVKFPRTLFNSLAQEHPNITIKISKIIAARMRAFI
DDPSRMGLKDNVVRSYKSSSTLNLRTVAILPVTAGVPVVEFGNRLMNALSQVGPPNGATC
LNQAAILNHLGKLAFNRMGKLKLSQYLADLEEKYGLVVYVADTNVNTPWTQTCITQADCL
LFVGLADSSPEIGEYERFMLGMKSTARKILVLVHQERYSNPGLTRQWLKNRMWINGGHFH
VQMAYTSNTVPIHPPTKRFGPSLKQRVQILQAEIQKYTSRKVRHVPFYSPDAPFKGDFHR
LARRLCGKSVGLVLGGGGARGIAHVGIIRAMEEAGIPIDMVGGTSIGAFIGGLYARHADV
VPIFGLAKKFAGRMASMWRFAFDLTYPSASYTTGHEFNRGIFKTFGKTQIEDFWLEYYCN
TTNISKSRVEFHTSGYAWRYIRASMSLAGLLPPLCDEGSMLLDGGYIDNLTVSRMKSLGS
DVIFAVDVGSLDDNTPQAFGDSLSGVWAFFNRWNPFSSVPNPPTLAEIQARLAYVSSVGE
LERAKTMPGCIYMRPPIDDYGTLDFGKFDEIYGVGYKYGQEFLQKLREQGVLPLVEETEA
KKALRRTMAPRRASI
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atggagtctcttagcaacctcggcaacgccatgagctcggtgctttccgagacaacgtcc
acgactgcgacggcaatcctcgccgatcctacagaagccctctcgtctgtcgtcgctctc
gccagcgatgcggtctcgaaagctactagcgatgtggttcccgaacacaccccgacttca
tggttcaccatcatcctctggctgttgcaccgcatctcgagtgtgctatactttgtcatc
aagctgaccaccatcactacacccacctttctgttcaacatcttttcgactagtctgacg
gtgaccatgaacgccactacgcttgtgcttattatgttgttcatgatggcaggagtgacc
tgggtagtcagatatcgctacttaaacatgtactcacggcttcctcctgagccccagcgc
aaagagccagctgttgatctgttccccgaaacacaggaggaaggagtaaagtctgggcta
gctagctactttgacgagtttctcagcgccatcaaaatctttggttatctggaaaggccg
gttttccatgaactgacccgcagcatgcaaacgaggaagctgatcgctggcgaaaccctc
aacctcgaagaagagcaaggattctgtcttgtggtcgacggtatggtggagatctttgtt
aaatccgccagagatggtcgacgctcaagcagtggcccttcgttcgagagcgacgatgag
gaaggctttgctccgggtcgccagcgctaccagcttctgaccgaagtgcggaacggtgcc
cccatgtcatcactgttctctatcatgtcactcttcactgaagatatccaaatgcatgac
accgacgacgacgacagccccgacccaacgccttccgctcctggcaccgctatgcctggt
tatcctatgaacgccaacttccagcagtcgaacgataccctcccgtccatcccaggtacc
ccattgtccgacaaccacgttatgcaacgtgggatggcttcggctgagtctctaacaatg
tctcccctagctcatgattcttcgaggataccatcactttctctcgtgaacactcgtcct
gctgtaccccgccggccggtaccgaagaggctcaataccacttcagcccatccagatatt
attgcgagagcgacagtggacactaccatagccattatccccgccagcgccttcaggcgt
ctgatcaagatatatcccaaggccactgcgcacatcgttcatgtcatcctttcgaggttt
caaagagtgacacttgccactgcttacaactaccttggcttgagcggcgaagtattgcag
atggagcgcaacatcttgaagcatacagttcggcaactccctaatcatctcagaggagac
gctttggatagactcaaggaaaagttcaagcgggaaagggaaagaattggagagaaggag
gtcgaaaagggcattgctcttcacaatgcgcatgccgcccgccgacgtcgttcggctgcc
tcccttcggaaagaagtggcattgcaggcatattcgaaaaggcggcagagcatcgtcacg
gcgacccctgcattcggaacacgtcgagaacgcccatcgcccgacatgcctagccccggc
gacttgctcacgaatacgcaacagttgaagtctgggccggcatcgcagcttgatctagcg
cgagacgctacatctcctcgaccacagcgaaatctcagtcccttctctactcctcgaaac
gcacatgtctctcttgacacgagggaagcccttgatgaagacgacatgttccgagagtcg
gtgctcgaatgcatgttcagggccattggcctgaccggtaacggaagtgtcaatccggat
tcgacgcaagcttccccaagatttgttcctacggaccagcgacgttcgaggggtggtccc
ggccacactgcttttggcttcatggatgccttcgacccgttcgacaacgacacggagtca
gttacctcttgtggatttagctcatcgtcaccagttcccaatcctcaactactcgcacac
gatatgaaggacgaggttgagatcgtcttctttcctaagggctctgtcttggtggagcaa
ggtgagagaaatcctggtctctattatgttattgatggtttcctcgacatttgtgttccg
ggcgacgattcatcacacgacctcctccagtcctcagccaaggtagaccatggccatgac
tcagcaactggtgccgacgcctttggggccaattcgtcacgctttcctgaaccgaacatg
aacaacaactttggtgctgagcagaagaaaggcaaacaaggtcgaaggagcgtggctctg
atcaaaccgggtggacttgctggttatgttggtaccatttcctcctacagatcgtttatc
gatgttgttgcgagaacggatgtctgtgtcggctttcttccacttgcctctattgacagg
atcgttgaccgttatcccatcgttatgcttactatggccaagcggcttacggagttactg
ccgcgtctgcttctgcacatcgactttgccctcgagtgggtgcaggtcaactctggccag
gttttgttccgcgaaggtgatgagagcgaagcaatttaccttgtcctcaatggccggtta
agactggttgaagatcaaaaagatggggggatgaacgtcaaagctgaattcggccaggga
gagagtatcggagagctggaagtgctgaccgaatccgcacgtaccggaactctacacgca
attcgcgaaactgaactggtcaaatttcctcgcacgcttttcaacagtttagcccaggaa
catcccaacatcactatcaaaatttccaaaattatcgcagcgcgaatgagggcctttatc
gatgatccttcacgcatgggactcaaagataacgtggttcggagctataagagctcttcg
acgctaaacctgagaaccgtggcaatcttacctgtcaccgcgggcgttcctgttgtcgag
tttggcaataggttaatgaacgccttgtcacaggttgggcctcctaacggcgcaacttgt
ctaaatcaagcagcgatcttgaatcacctcgggaaactcgcattcaacaggatgggaaag
ctcaaactgtcccagtacctcgcagatctagaagagaaatacggactcgttgtctacgta
gctgacacgaacgtcaacacgccatggacccagacgtgcattacgcaagctgattgctta
ttgtttgtcggtcttgcggacagctcccctgaaatcggagagtatgagcggttcatgctt
ggaatgaaatcaacggcccgaaaaatcctcgtcctcgttcaccaagagcgctactccaac
cctggtctgacgaggcagtggctgaagaaccgaatgtggatcaatggaggccacttccat
gtgcaaatggcatatacctccaacactgtgcctatccatccgcccacgaaacggttcggg
ccaagcctcaagcagcgggttcagatcttgcaggcagagattcagaagtacacctccagg
aaagttcgccatgttcccttctactctcccgatgctccgttcaagggagacttccatcgg
ttggcgaggcggctgtgcggcaagtccgtgggtctggtcctaggtggtggtggcgccaga
ggcattgcgcatgttggcatcatcagagcgatggaagaggctggaatccccattgacatg
gtcggagggacgtcaattggagccttcatcggcgggttgtatgccaggcatgcagatgtt
gttcccatcttcggtttagccaagaagttcgctggacgtatggccagcatgtggaggttc
gcttttgacctgacatatccgtccgcctcctacacaaccggccacgagttcaaccgcggc
atcttcaagacctttggaaaaacgcagattgaagatttctggctggaatactactgcaat
accactaacatcagcaaaagccgagtcgagttccacaccagtggttacgcatggcgctac
atccgagcgtccatgtccctggcgggtttacttccacctctgtgtgacgaaggcagcatg
cttttggacggcggctacatcgacaatttgactgtatcccgtatgaaatctctcggttcg
gacgtcatttttgctgttgacgtcggctcgcttgatgataatacgcctcaggcctttggc
gactctctgtctggtgtatgggcattcttcaaccgctggaacccattctcatcggtaccc
aacccgcccacgctggcagagatccaggcccgccttgcgtatgtgtcgagtgtcggtgag
ctagagagggcaaagacgatgcccggatgcatatacatgcggcccccgatcgacgactac
ggaacgctggattttggcaaatttgacgagatctatggggtcgggtacaaatatggccag
gagttcctccagaagttgagggagcagggtgtattgcctctggttgaggagacagaggcg
aagaaagcgttgaggagaacgatggcgccgaggcgcgcgagtatatag

DBGET integrated database retrieval system