KEGG   Neurospora crassa: NCU08378Help
Entry
NCU08378          CDS       T01034                                 

Definition
similar to CREB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 827 aa AA seqDB search
MQGSSKTDSNASSKNKKDEPAVELTPLERILQNAGPLREDGSDNYCNSILQALYYSEPFR
ENVVNYPPSNNTSEGNTSKVKVSIRPPVQVNGNAATPGKQLPKPRQGFTPGPIPMPITQP
IRPEDRPDAPEYKKKQAMIKGPVLELTQENPDAYGMEECTFTGLKDIFTALIQSNSRTGV
ISPQRFLDIFKRDNEMFRNSMHQDAHEFYGLVLNDVISNVEAYARRMQESRKEIGTTSSP
LNQQSSSPSLTRSLMASNLRTPETSWVHDIFEGVLVSETRCLTCETVSQRDETFLDLSID
LEEHSSVTSCLRKFSAEEMLCERNKFHCDRCGGLQEAEKRMKIKKLPKVLALHLKRFKYT
EDYSRLQKLFHRVVYPYYLRMFNTTDDAEDPDRIYELYAVIVHIGGNAYHGHYVSIIKTK
DRGWVLFDDEMVEPVDKNFVANFFGDKPGMACAYVLFYQEVTFEKMREELDAEGLEEMRL
ATQAADLAAGAEQTNGTGNDSLTKVNSQPTVPVEDLDPSTPGPEPFSHPLVAAPPPAPAV
ITKADEAATVPPKSKDELTKEKKEQKAQEKAQEKARKAAEKEAARLAEKERLEKVAKKRG
VQQKEQEQLAKVMRESKQLAAEEEKRRKKEAAAAETGTKSGPSSPRLFNRAGLGGKSLSR
KSFAFLGKTGGGGGSGGGGGGSDKSEKSSDKDKSDRAESSSTEQRSNDSMTSNGVAESNA
SSRATTGDGHGGNRFGGFSPSSPSSPLSPTSRGPNGIYSHNHHLPSSPMRSMTTPDGIKR
DVRASRSASTSSILGPPPTAPERFEKPPLRDRFSFSMGRKKSSRFLS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaagctccaaaaccgacagcaatgcctcgtctaagaacaaaaaggacgagccg
gcggtggaattgactccccttgagagaatactgcaaaatgctgggcctctgcgggaagac
ggaagcgacaactactgcaattcgatccttcaagcgttatactattcggaacctttccga
gagaatgtcgttaactacccgccttcaaataacacgtcagaaggcaatacgagcaaggtc
aaagtctcgatacggccaccggtacaagtcaacggaaatgcggcgacgcccggcaagcaa
ttgcccaaaccgcggcaagggttcactcctggaccaataccgatgccaataacgcaaccg
atacgacccgaagacaggcctgatgccccagaatacaagaaaaagcaggccatgattaaa
ggacccgtgttggagttgacccaggaaaatccagatgcgtacggcatggaggaatgcacg
ttcaccgggctcaaggatatttttactgctctgattcaaagcaactccaggaccggtgtc
atcagcccacagcgctttctggatatcttcaagcgcgacaatgaaatgttccgcaattct
atgcaccaagacgcacacgaattttacggccttgtattgaacgatgttatctcgaatgtg
gaggcatatgctaggcgtatgcaggagagcaggaaggagattggaacgacatcgtctcca
ttgaaccaacaatcgtcatctccaagccttacgaggagcttgatggcatccaacctcagg
acgccagagacaagctgggtgcacgacatttttgaaggcgtcctagtttccgaaaccagg
tgcttgacttgcgagacggtgtcacaacgagacgaaacgtttttggatctctcaatcgat
ctggaagagcattcttcggtaacgtcatgcctacggaaattttccgcagaggagatgctt
tgcgagaggaacaagtttcactgcgatcgttgtggcggcttgcaagaggccgaaaagagg
atgaagattaagaagctaccaaaggttttggcgttgcatctgaagaggttcaagtatacc
gaggactacagccgactccaaaagctgtttcatcgtgtcgtctacccatattatcttcgc
atgttcaatacgacggacgatgctgaagacccggacaggatttacgagttatacgcagtt
attgtccatattggaggtaacgcctaccacggacactacgtgtcaattatcaagaccaag
gatcggggctgggttttgttcgatgacgaaatggtcgagcccgttgacaagaatttcgtg
gcgaacttctttggtgacaagccaggcatggcttgcgcctacgtactattctaccaggaa
gtcacctttgagaagatgagggaagagttggatgccgaaggactagaagagatgaggtta
gccacccaagcagccgacctggcagccggtgcggaacaaacgaacgggaccggaaatgac
tccttaacaaaggtcaacagtcagccgacagtaccggtcgaagaccttgacccatcgacc
cccggacccgagcctttctcccatcctctagttgcggcaccacctccggcccctgccgtc
ataacgaaggcggacgaggcggccacggttccgcccaaatccaaggatgaacttaccaag
gagaaaaaggaacagaaagcccaagagaaagcacaggaaaaggcccgaaaagccgccgag
aaagaggcagcaaggctcgcagaaaaggagcgtctcgagaaggtcgcaaagaagcgcgga
gtacagcaaaaagagcaggagcagctggcaaaggtcatgcgcgagagcaaacagctggcg
gccgaggaagaaaaaaggcgcaagaaggaggcggcagccgctgaaacaggcactaagagt
ggccccagcagtcccaggctgttcaatcgcgccggcctgggtggcaagtctctctcacgc
aagagctttgcttttctgggaaagaccggcggtggtggtggtagtggtggtggtggcggt
ggcagcgacaagtccgagaaaagcagcgacaaagacaagagtgacagggcggaaagcagc
agtacagagcagaggagcaacgacagtatgaccagcaacggcgtggctgagagcaacgcg
agtagccgcgcgacgactggtgatggtcatggtggcaaccgctttggcggattctcgccg
tcgtcgccgtcgtcgccgttatcgcccacgtcacgaggaccgaacggcatttattcccac
aatcaccacctgccgagctcgccgatgagatccatgacgacgccagacggtatcaagaga
gacgtgcgagcgtctaggtcagcctcgacgtcctccatactcggcccgccccctacggct
ccggagaggttcgagaagccgccgctgcgagaccggttcagcttcagcatggggaggaag
aagagttcacggttcctatcgtag

DBGET integrated database retrieval system