KEGG   Neurospora crassa: NCU08378Help
Entry
NCU08378          CDS       T01034                                 

Definition
similar to CREB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCU08378
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU08378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I
AA seq 827 aa AA seqDB search
MQGSSKTDSNASSKNKKDEPAVELTPLERILQNAGPLREDGSDNYCNSILQALYYSEPFR
ENVVNYPPSNNTSEGNTSKVKVSIRPPVQVNGNAATPGKQLPKPRQGFTPGPIPMPITQP
IRPEDRPDAPEYKKKQAMIKGPVLELTQENPDAYGMEECTFTGLKDIFTALIQSNSRTGV
ISPQRFLDIFKRDNEMFRNSMHQDAHEFYGLVLNDVISNVEAYARRMQESRKEIGTTSSP
LNQQSSSPSLTRSLMASNLRTPETSWVHDIFEGVLVSETRCLTCETVSQRDETFLDLSID
LEEHSSVTSCLRKFSAEEMLCERNKFHCDRCGGLQEAEKRMKIKKLPKVLALHLKRFKYT
EDYSRLQKLFHRVVYPYYLRMFNTTDDAEDPDRIYELYAVIVHIGGNAYHGHYVSIIKTK
DRGWVLFDDEMVEPVDKNFVANFFGDKPGMACAYVLFYQEVTFEKMREELDAEGLEEMRL
ATQAADLAAGAEQTNGTGNDSLTKVNSQPTVPVEDLDPSTPGPEPFSHPLVAAPPPAPAV
ITKADEAATVPPKSKDELTKEKKEQKAQEKAQEKARKAAEKEAARLAEKERLEKVAKKRG
VQQKEQEQLAKVMRESKQLAAEEEKRRKKEAAAAETGTKSGPSSPRLFNRAGLGGKSLSR
KSFAFLGKTGGGGGSGGGGGGSDKSEKSSDKDKSDRAESSSTEQRSNDSMTSNGVAESNA
SSRATTGDGHGGNRFGGFSPSSPSSPLSPTSRGPNGIYSHNHHLPSSPMRSMTTPDGIKR
DVRASRSASTSSILGPPPTAPERFEKPPLRDRFSFSMGRKKSSRFLS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaagctccaaaaccgacagcaatgcctcgtctaagaacaaaaaggacgagccg
gcggtggaattgactccccttgagagaatactgcaaaatgctgggcctctgcgggaagac
ggaagcgacaactactgcaattcgatccttcaagcgttatactattcggaacctttccga
gagaatgtcgttaactacccgccttcaaataacacgtcagaaggcaatacgagcaaggtc
aaagtctcgatacggccaccggtacaagtcaacggaaatgcggcgacgcccggcaagcaa
ttgcccaaaccgcggcaagggttcactcctggaccaataccgatgccaataacgcaaccg
atacgacccgaagacaggcctgatgccccagaatacaagaaaaagcaggccatgattaaa
ggacccgtgttggagttgacccaggaaaatccagatgcgtacggcatggaggaatgcacg
ttcaccgggctcaaggatatttttactgctctgattcaaagcaactccaggaccggtgtc
atcagcccacagcgctttctggatatcttcaagcgcgacaatgaaatgttccgcaattct
atgcaccaagacgcacacgaattttacggccttgtattgaacgatgttatctcgaatgtg
gaggcatatgctaggcgtatgcaggagagcaggaaggagattggaacgacatcgtctcca
ttgaaccaacaatcgtcatctccaagccttacgaggagcttgatggcatccaacctcagg
acgccagagacaagctgggtgcacgacatttttgaaggcgtcctagtttccgaaaccagg
tgcttgacttgcgagacggtgtcacaacgagacgaaacgtttttggatctctcaatcgat
ctggaagagcattcttcggtaacgtcatgcctacggaaattttccgcagaggagatgctt
tgcgagaggaacaagtttcactgcgatcgttgtggcggcttgcaagaggccgaaaagagg
atgaagattaagaagctaccaaaggttttggcgttgcatctgaagaggttcaagtatacc
gaggactacagccgactccaaaagctgtttcatcgtgtcgtctacccatattatcttcgc
atgttcaatacgacggacgatgctgaagacccggacaggatttacgagttatacgcagtt
attgtccatattggaggtaacgcctaccacggacactacgtgtcaattatcaagaccaag
gatcggggctgggttttgttcgatgacgaaatggtcgagcccgttgacaagaatttcgtg
gcgaacttctttggtgacaagccaggcatggcttgcgcctacgtactattctaccaggaa
gtcacctttgagaagatgagggaagagttggatgccgaaggactagaagagatgaggtta
gccacccaagcagccgacctggcagccggtgcggaacaaacgaacgggaccggaaatgac
tccttaacaaaggtcaacagtcagccgacagtaccggtcgaagaccttgacccatcgacc
cccggacccgagcctttctcccatcctctagttgcggcaccacctccggcccctgccgtc
ataacgaaggcggacgaggcggccacggttccgcccaaatccaaggatgaacttaccaag
gagaaaaaggaacagaaagcccaagagaaagcacaggaaaaggcccgaaaagccgccgag
aaagaggcagcaaggctcgcagaaaaggagcgtctcgagaaggtcgcaaagaagcgcgga
gtacagcaaaaagagcaggagcagctggcaaaggtcatgcgcgagagcaaacagctggcg
gccgaggaagaaaaaaggcgcaagaaggaggcggcagccgctgaaacaggcactaagagt
ggccccagcagtcccaggctgttcaatcgcgccggcctgggtggcaagtctctctcacgc
aagagctttgcttttctgggaaagaccggcggtggtggtggtagtggtggtggtggcggt
ggcagcgacaagtccgagaaaagcagcgacaaagacaagagtgacagggcggaaagcagc
agtacagagcagaggagcaacgacagtatgaccagcaacggcgtggctgagagcaacgcg
agtagccgcgcgacgactggtgatggtcatggtggcaaccgctttggcggattctcgccg
tcgtcgccgtcgtcgccgttatcgcccacgtcacgaggaccgaacggcatttattcccac
aatcaccacctgccgagctcgccgatgagatccatgacgacgccagacggtatcaagaga
gacgtgcgagcgtctaggtcagcctcgacgtcctccatactcggcccgccccctacggct
ccggagaggttcgagaagccgccgctgcgagaccggttcagcttcagcatggggaggaag
aagagttcacggttcctatcgtag

DBGET integrated database retrieval system