KEGG   Neurospora crassa: NCU08409Help
Entry
NCU08409          CDS       T01034                                 

Gene name
trp-3
Definition
(RefSeq) tryptophan-3
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ncr  Neurospora crassa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCU08409 (trp-3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCU08409 (trp-3)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCU08409 (trp-3)
Enzymes [BR:ncr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCU08409 (trp-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Linkage Group II; II
AA seq 708 aa AA seqDB search
MEGIKQTFQRCKAQNRAALVTYVTAGFPHPEQTPDILLAMEKGGADVIELGVPFTDPIAD
GPTIQTANTIALQHGVTLQSTLQMVRDARQRGLKAPVMLMGYYNPLLSYGEERLLNDCKE
AGVNGFIIVDLPPEEAVSFRQLCTRGGLSYVPLIAPATSDARMRVLCQLADSFIYVVSRQ
GVTGASGTLNANLPELLARVKKYSGNKPAAVGFGVSTHDHFTQVGAIADGVVVGSMIITT
IQKAAKGEEVKAVQEYCSYLCGRNFEQSAHELNMGEALEAAKEPVGTATVDGVITEADID
AQLAALHGTIPKRFGEFGGQYVPEALMDCLSELEEGFNKIKDDPAFWEEYRSYYPWMGRP
GQLHKAERLTEYAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKKKIIAETGAGQH
GVATATVCAKFGMECTVFMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVNEALR
YWVVNLADTHYIIGSAIGPHPFPTIVRTFQSVIGNETKQQMLEKRGKLPDAVVACVGGGS
NAVGMFYPFSNDPSVKLLGVEAGGDGVDTPRHSATLTAGSKGVLHGVRTYILQNQYGQIE
DTHSISAGLDYPGVGPELSNWKDTERAKFVAATDAQAFEGFRLMSQLEGIIPALESSHGI
WGALELAKTMKPDEDVVICLSGRGDKDVQSVADELPIIGPKIGWDLRF
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggagggtattaagcagactttccagcgctgcaaggcccagaacagggccgcgctcgtc
acctatgtcacggccggtttcccgcaccccgagcagacccccgatattctcctggccatg
gagaagggcggcgccgacgtgatcgagctcggtgtcccctttaccgaccccattgctgat
ggcccgaccatccagactgccaacactattgctctccagcatggcgttaccctccagtcg
accctgcagatggtgcgcgacgcccgccagcgcggcctcaaagcccccgtcatgctcatg
ggctactacaaccctctgctcagctacggcgaggagcgtctcctcaacgactgcaaggag
gccggcgtcaacggcttcatcattgttgacttgccccctgaggaggccgtctccttccgc
cagctctgcacccgcggcggtctctcctacgtccccttgattgcgcccgccacctcggac
gcccgtatgcgcgttctctgccagctcgccgactccttcatctacgttgtctcccgccag
ggtgtcaccggcgcttccggcactctcaacgccaaccttcccgagctcctcgcccgcgtc
aagaagtacagcggcaacaagcccgctgccgttggtttcggtgtcagcacccacgaccac
ttcactcaggttggcgccattgccgacggtgtcgttgttggtagcatgatcatcaccact
atacagaaggccgccaagggtgaggaggtcaaggctgtccaggagtactgctcctacctg
tgcggacgcaacttcgagcagtccgctcacgagctcaacatgggcgaggccctcgaagct
gccaaggaacctgtgggtactgccaccgtcgacggcgtcatcaccgaggccgacattgac
gctcagctcgccgctctccacggcaccatccccaagcgtttcggcgagttcggtggtcag
tacgtccctgaggcgctcatggactgcttgtccgagcttgaggagggtttcaacaagatc
aaggacgatcccgctttctgggaagagtatcgctcttactacccctggatgggccgtccc
ggtcagctccacaaggccgagcgtctcaccgagtacgctggtggcgccaacatctggctg
aagcgtgaagatctcaaccacactggttcccacaagatcaacaacgctcttggccagctg
ctgctcgcccgcagactcggcaagaagaagattattgccgagaccggtgccggtcagcac
ggtgtcgccactgccaccgtgtgcgccaagttcggcatggagtgcaccgtcttcatgggt
gccgaggatgtccgtcgccaggctctcaacgtcttccgcatgaagcttctcggcgccaag
gtcgtcgccgttgaggccggcagccgcaccctccgtgacgccgtcaacgaggctctccgc
tactgggttgtcaacctcgccgatacccactacatcatcggttccgccattggccctcac
cccttccccaccattgtgcgtactttccagtccgtcatcggcaacgagaccaagcagcag
atgctggagaagcgcggcaaactccccgacgctgtcgtcgcctgcgttggtggtggtagc
aatgccgtcggcatgttctaccccttctccaacgaccccagcgtcaagcttctcggtgtt
gaggccggtggtgacggtgtcgacactccccgccacagtgctacccttaccgccggcagc
aagggtgtcttgcacggtgtccgtacctatatccttcagaaccaatacggccagatcgag
gacacccactccatctctgccggtcttgattaccccggtgtcggcccggagctgtccaac
tggaaggataccgagcgcgccaagtttgtggctgccacggatgcccaggcctttgagggt
ttccgtctgatgagccagctggagggtatcattcccgcgctggagtcttcccacggtatc
tggggtgctctggagctggccaagaccatgaagccggacgaggatgttgtcatttgcttg
tcgggtcgcggtgacaaggatgttcagagcgttgctgatgagcttcctattattggcccc
aagattggctgggacttgcgcttttaa

DBGET integrated database retrieval system