KEGG   Neurospora crassa: NCU08535Help
Entry
NCU08535          CDS       T01034                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ncr  Neurospora crassa
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NCU08535
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCU08535
   00640 Propanoate metabolism
    NCU08535
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NCU08535
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NCU08535
Enzymes [BR:ncr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NCU08535
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NCU08535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 2275 aa AA seqDB search
MADTTASDAVVQASYAAKHNLAPHFIGGNRLENAPPSKVKDFVASHDGHTVITNVLIANN
GIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYVEVPGGTNNHN
YANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRSLGDKI
SSTIVAQHADVPCIPWSGTGVSEVKVDDNGIVTVPDDVYLKGCVSSWQEGLEKAREIGFP
VMIKASEGGGGKGIRKVLNEDNFESLYNAAASEIPGSPIFIMKLADSARHLEVQLLADQY
GNNISLFGRDCSVQRRHQKIIEEAPVTIAKPMTFKAMEEAAVRLGRLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQVAMGIPLHRIRDIRLLYGVDPRT
ASEIDFEFKNPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSNGVLHDLNFRSSSNVWG
YFSVGSAGGIHSFSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRTTVEYLIKLLE
TEAFEENTITTGWLDELISKKLTAERPDPILAVVCGAVTKAHIASEGCMTEYRAGLEKGQ
VPSKDILKTVFPVDFIYEGYRYKFTVTRSSADSYHLFINGSKCTVGVRALSDGGLLILLN
GRSHNVYWKEEVAATRMSVDSKTCLLEQENDPTQLRTPSPGKLVKYTVENGEHVSAGQTF
AEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKQAQPFLGQLPEF
GAPVVVGSKPAQRFRLLYDTLQNILMGYDNQIIMQQTLKDLIEVLRDPKLPYSEFTAQFS
ALHARMPQKLDAQLTQVLEKASSRSAEFPARNLGKVFQKFLDENVASKVDAELLKTTLAP
LTTVIDQYSEGQKVHELNVIRDLLTSYVEVERLFSGRRLQDEEVILKLRDENKEDIKKVT
QTVLSHSRVAAKNSLILAILDEYRPNKPNVGNVSKYLRPVLRKLAELESRQTAKVSLKAR
EILIQCALPSLEERTAQMEHILRSSVVESRYGETGWDHREPSLDIIKEVVDSKYTVFDVL
TLFFAHEDPWVSLAALEVYVRRAYRAYVLKKIEYHTDETETPSFLSWDFSLRKLGHSEFG
LPIQSAAPSTPGTPVDSTFKRISSISDMSYLSHKTQDEPTRKGVIIPCKFLDDADELLSR
ALEKLPVLGARKRNSVIPDLNEKRRPPLQRLETFDELSAVVNVAVRDAEGRSDEEILKEI
LPLVHQHREDLFARRVRRITFVCGRNDGSYPGYFTFRGPEYVEDDSIRHSEPALAFQLEL
GRLSKFKIKPVFTENKNIHVYEAIGKGVETDKRYFTRAVIRPGRLRDEIPTAEYLISEAD
RVINDIFDALEIIGNNNSDLNHMFLNFTPVFQLQPEEVEHSLQGFLDRFGPRGWRLRVAQ
VEIRIICTDPATGMPYPLRVIITNTSGYVIQVELYAERKSEKGEWVFHSIGGTTKIGSMH
LLPVNTPYPTKNWLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWVKAVRMDSSLADKQPP
VGECIEFSELVLDDHDNLIEVSREPGTNTCGMVGWLIRARTPEYPNGRKFVVVANDITFN
IGSFGPKEDNFFFKCTELARKLGIPRIYLSANSGARLGLATELMPHFSVAWNDPSKPEAG
FKYLYLDDAGKKRFENTVITEEITEGDEKRHKIVTIVGAEDGLGVECLRGSGLIAGATSR
AYNDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAPALNNVLGRQVYTSNLQL
GGTQIMYRNGVSHLTANDDFAGVSKIVEWMSFVPDKRNNPVPISVSVDTWDRDVVYTPPQ
KQPYDVRWMIGGKEDENGYQPGLFDKDSFVETLGGWARTVVVGRARLGGIPMGVIAVETR
SVENITPADPANPDSIEQVANEAGGVWYPNSAFKTAQAINDFNNGEQLPLMILANWRGFS
GGQRDMYNEVLKYGSFIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPTINPVAMEMYAD
VDARGGVLEPEGIIGIKYRKDKQLETMARLDPVYADLKRQSADASLPKEESDAIKQKMTE
REQQLLPVYAQISVQFADLHDRAGRMKAKGVIREVLEWQNARRFFYWRVRRRLNEEYILR
RIISATTPGGAPSKALTASSTKERARHLQLLQAWSGIEKFDTADREVAVWYEENRHLVQT
KIDALKAEAITTEMRDLIRAASKGSDDAAWKGVRDILSVMPVEEREKVVKYLTTL
NT seq 6828 nt NT seq  +upstreamnt  +downstreamnt
atggcggacacaacagcgagcgacgccgtcgtccaggcttcgtatgccgccaagcacaac
ctggccccccatttcattggcggcaacaggcttgagaatgcccctccctccaaggtcaag
gactttgtggcctcccacgatggtcacactgtcatcaccaacgtccttattgccaacaac
ggtattgctgccgtcaaggagattcgctcagtaaggaaatgggcttacgaaacattcggc
gacgagcgcgccatcaagttcaccgttatggccacccccgaagatctgcaggccaacgcc
gactacatcaggatggccgatcactatgttgaagtccccggcggcacaaataaccacaac
tatgccaacgtcgagctgatcgtggatattgccgagcgtatggatgtccacgccgtgtgg
gctggttggggtcacgcctccgaaaaccccaagctccccgagtcccttgcggcttccccc
aagaagattgtcttcattggtcctccgggttctgccatgcgctcccttggtgacaagatt
tcctcgacaattgttgcccagcacgccgacgttccctgtatcccttggtctggtaccggt
gttagcgaggtcaaggtcgacgacaatggcattgttacggttcccgatgacgtttacctc
aagggctgcgtcagctcgtggcaggagggtctggaaaaggccagggaaattggtttccca
gtaatgatcaaggcctccgaaggtggtggtggcaagggtatccgcaaggtcctcaacgag
gacaacttcgagtcgctctacaacgctgccgctagcgaaattcccggctcacccattttt
atcatgaagctcgccgacagcgccaggcatttggaggttcagcttcttgctgatcagtac
ggcaacaacatctcccttttcggcagagattgctcggtccagcgcagacatcaaaagatt
atcgaagaggcccccgtcaccatcgccaagcccatgaccttcaaggccatggaggaggct
gctgtccgtcttggtcgtctcgtcggttacgtctcggccggtaccgtcgagtacctctac
tcccacgccgatgacaagttctacttcctcgagttgaacccccgtctgcaggtcgagcat
cctaccactgaaatggtcagtggtgtcaaccttccggctgctcagctccaggttgccatg
ggtattcccctccaccgcatccgcgacatcagactgctctacggcgtcgaccccaggact
gccagcgagatcgacttcgagttcaagaaccccgagtccgagaagacccagcgcaggcct
acccccaagggccacaccactgcctgccgtatcacctccgaggatcccggtgagggtttc
aagccatccaacggtgtgttgcacgatctcaacttccgttcgagctccaacgtctggggt
tacttctccgtcggttctgccggtggtattcacagtttctccgactcgcagttcggtcac
atctttgcctatggcgagaaccgtgccgcctcccgaaagcacatggtcgttgccctcaag
gaattgagcatccgcggtgacttccgtaccaccgtcgagtacctcatcaagcttttggag
actgaggccttcgaggagaacaccatcactaccggctggctcgatgagcttatttccaag
aagctcactgctgagcgtcccgaccccattctggccgttgtttgcggtgccgtcaccaag
gcccacattgcgagcgaaggctgcatgaccgagtaccgtgctggccttgagaagggtcag
gtcccctccaaggacatcctcaagactgtcttccccgtcgactttatctacgagggttac
cgctacaagttcaccgtcaccaggtcgagcgccgatagctaccatctcttcatcaacggc
tccaagtgcactgtcggcgttcgtgctctgagcgatggtggactcctcatccttctcaac
ggccgcagtcacaacgtttactggaaggaagaggtcgctgctacccgcatgtcggtcgat
agcaagacctgtctgctggagcaggagaacgatcccacccagttgcgcaccccctctccc
ggtaagctcgtcaagtacaccgtcgagaacggcgaacacgtcagcgccggccagaccttc
gctgaggtcgaggtcatgaagatgtacatgcctctcattgcccaggaggatggtatcgtc
cagcttatcaagcagcccggcgctactctcgaggccggtgacattcttggtatcctcgct
ctcgatgatcccagccgtgtcaagcaggcccagcctttcctcggccagcttcccgagttt
ggtgcccctgttgttgtcggcagcaagcccgctcagagattccgccttctctatgacact
cttcagaacatcctcatgggctacgacaaccagatcatcatgcagcagaccctgaaggat
ctgattgaagttcttcgtgaccccaagctcccttacagcgagttcaccgctcaattctca
gcccttcatgcccgtatgcctcagaagctcgacgcccaacttactcaggtcctcgaaaag
gcctcttcgcgttcggccgagttccctgcccgcaatctcggcaaggtcttccagaagttc
ctggacgagaacgttgcctccaaggttgacgctgagctgctgaagaccaccttggcccct
ctcaccaccgtcatcgaccagtactctgagggccagaaggtccatgagctcaatgtcatt
cgcgatcttcttacttcttacgtcgaggtcgagcgtctcttttctggccgtcgtctgcag
gacgaggaggttattctcaagctgcgtgatgagaacaaggaggacatcaagaaggtcacc
cagactgttctctctcacagcagggttgcggccaagaactcgctcattctcgcgattctg
gacgagtaccgccccaacaagcccaacgttggcaacgtcagcaagtaccttcgtcccgtc
cttcgcaagcttgccgagctcgagtctcgtcagactgccaaggtttccctcaaggctcgt
gagatcttgatccagtgcgctttgccctctctcgaggagagaaccgctcagatggagcac
attcttcgctcctctgtcgtcgagtctcgctacggtgagactggctgggatcaccgtgag
cctagcttggacatcatcaaggaggttgtggactccaagtacactgtctttgatgtcctg
acccttttctttgcccacgaggatccttgggtgtccctcgctgcccttgaggtctatgtg
cgccgcgcctaccgcgcttacgttttgaagaagattgagtaccacaccgatgagaccgag
actccttccttcttgtcctgggatttctctctgcgcaagcttggccactccgagttcggc
ctgcccatccagtccgctgccccctccaccccgggtacacctgtggacagcaccttcaag
cgcatcagctctatcagcgatatgtcctacctttcccacaagactcaggatgagcctacc
cgcaagggtgtgatcattccctgcaagttcttggatgatgcggatgagctcctcagtagg
gctcttgagaagctccccgtgctcggagcccgcaagagaaacagcgtgattcccgatctc
aacgagaagcgcagacctcctcttcagcgcctggagaccttcgacgagctctccgctgtc
gtcaacgttgccgtccgtgatgccgagggtcgcagcgacgaggagattcttaaggagatt
cttcctcttgtgcaccaacacagggaggacctgtttgcccgccgggtccgccgcatcaca
ttcgtctgtggtcgcaacgatggctcctaccctggctacttcactttccgtggccctgag
tacgttgaggacgatagcatccgtcacagcgagcctgctcttgcgttccagctcgagctc
ggacgtctgtccaagttcaagatcaagcctgtcttcaccgagaacaagaacattcatgtg
tacgaggcgattggcaagggtgtcgagaccgacaagcgctacttcactcgcgctgtcatt
cgtcctggccgtctgagggacgagattcctactgccgaatacctcatctcggaggccgat
cgcgtcatcaacgacattttcgatgctcttgagattatcggcaataacaattccgatctc
aaccacatgttcctgaacttcactccggtcttccagcttcagcccgaggaagttgagcac
tccctccagggcttccttgaccgcttcggccctcgtggctggcgcctccgtgttgcccag
gttgagattcgcatcatctgcactgaccctgctactggcatgccctacccgttgcgtgtt
atcatcaccaacacctccggctatgtcatccaggtcgagctctacgccgagcgcaagtcg
gagaagggcgagtgggtgttccactccatcggtggcaccaccaagatcggctccatgcac
ttgctgccggtcaacacgccgtaccccaccaagaactggctccagcctaagcgttacaag
gctcacctcatgggcacccagtacgtctatgacttccctgagctcttccgccaggctatc
cagaacagctgggtcaaggctgtccggatggactcgtctcttgccgacaagcagccccct
gttggcgagtgcattgagttcagcgagctcgtgcttgatgaccacgacaacttgatcgag
gtctcgcgtgagcctggcaccaacacttgcggcatggttggatggctcatccgtgcgaga
acccccgagtaccccaacggtcgcaagttcgttgtcgtcgccaacgacatcaccttcaac
atcggctcgttcggtcccaaggaggacaacttcttcttcaagtgcactgagcttgcccgt
aagctgggtattcctcgcatctacctgtccgccaactcgggtgcccgcttgggtctcgct
accgagcttatgcctcacttcagcgttgcctggaacgaccccagcaagcccgaggctggc
ttcaagtacctctacctcgacgatgcgggcaagaagcgctttgagaacactgtcatcacc
gaggagattaccgaaggagacgagaagcgccacaagattgtcacgatcgttggtgctgag
gatggtctcggtgttgagtgcttgcgtggctctggtctcattgccggtgccaccagcagg
gcctacaacgatatctttacctgcacgctcgtcacctgccgctccgttggtattggtgct
taccttgtccgtcttggtcagcgtgctgttcagattgagggccagcccatcattctcact
ggtgcccctgccctcaacaacgtcttgggtcgccaggtctacacctccaacctgcagctt
ggtggtacccagatcatgtaccgcaacggtgtctcccatttgaccgccaacgatgacttt
gctggtgtctccaagatcgtcgagtggatgtcgtttgttcctgacaagcgcaataaccct
gtgcctatcagcgtcagtgtcgacacttgggatcgtgacgttgtctacaccccgcctcag
aagcagccttacgacgtcaggtggatgatcggtggcaaggaggacgagaacggctaccag
cctggtctcttcgacaaggactccttcgtcgagactcttggtggatgggccaggactgtc
gtcgttggtcgcgctcgccttggcggtatccccatgggtgtcatcgctgtcgagacccgc
tctgttgagaacatcactcctgccgatcccgccaaccctgactcgatcgagcaggtggcc
aacgaggctggtggtgtctggtaccccaactccgccttcaagaccgcccaggccattaac
gacttcaacaatggcgagcagcttccgctcatgatccttgccaactggcgtggtttctct
ggtggtcagcgcgacatgtacaacgaggttctcaagtacggttctttcatcgtcgacgcc
ctcgtcaagttcgagcagcctgtcttcatctacattcctcccttcggcgagcttcgtggt
ggctcgtgggtcgtcgtcgatcccaccatcaaccctgtcgccatggagatgtatgctgat
gtggatgctcgcggtggtgttttggagcctgagggtatcattggtatcaagtaccgcaag
gacaagcagcttgagactatggcccgccttgaccccgtctatgccgacctcaagaggcag
agcgccgatgccagcctccccaaggaggagtctgatgcgatcaagcagaagatgactgag
cgcgagcagcagcttctgcccgtttatgctcagatcagcgtgcagttcgctgatctccac
gatcgcgctggtcgcatgaaggccaagggtgtcattcgcgaggttcttgagtggcagaac
gcccgccgcttcttctactggcgtgtgcgcagaagactcaacgaggagtacattctccgt
cgcatcatctcggctactactcctggcggtgccccaagcaaggctctcactgccagctcg
accaaggagcgcgctcgccacctccagcttctccaggcctggagcggcattgagaagttc
gacaccgccgaccgcgaggttgccgtctggtacgaggagaaccgccacctggtccagact
aagatcgatgccctcaaggccgaggcgatcaccacggagatgcgcgacctcatccgcgct
gcctccaagggctctgatgacgctgcctggaagggtgtccgtgatatcctgagcgttatg
ccggttgaggagagagagaaggtcgtcaagtaccttactactctctaa

DBGET integrated database retrieval system