KEGG   Neurospora crassa: NCU08579Help
Entry
NCU08579          CDS       T01034                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCU08579
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU08579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 675 aa AA seqDB search
MNIKEKEEEEEEEEEEEEEEGGEGGLLLESALTNRLKPTTACRKAVKDYVRHKIMPDKTL
TVAAYAAGASLAAITLIYVFGPTYFLDNDPSANSTSVFSIKRNGAVGLINPANDCFINSV
LQALAGLGDLRLYLIRETHRRCLDGGWVYAQTIPSDVWGSGGEGEGDETSKWQVRGGVPE
WKAEGLQMGIVTKGLKDILDALNERPIYKKTISASPFVRTLEIAFGQRISRQQQDAQEFL
QVVAERLCDEYHAGQRARSYAMRGAEQPTTKISLNSKTSDSEALDRPLPLRASEQVSGAD
QPAATAASAVPNGADEERAEEGFPFEGSFESQIECLTCGFRPRPTQSTFCTLTLNVPHIP
TTTLSACFDGMFKTEYIEDFKCEKCRLLHAKAVLEADIQRSTSESSREKARTALASLELA
IETDPEKAPKGVELPDPRYAPKRKIARHIRMTGFPRILAIHLSRSIYDMSNFSQKNLAKV
TFPELLPLGGLLQQRKYKLLGVVTHKGNHHSGHYESFRRQNIYPPFSNPGTFQPSGAYIY
TSSPSNINPGQAIQPGSGQAPTPGVEGGITPANEPRSTSTSRERDTDTNSLRSAAASARS
TLIKIASKPSSRAGSPDITGSKPHTKTPVKSKRHKSSSRWWRISDDKVKEASTRDVLGMQ
REVYLLFYELERENS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaggagaaggaggaggaggaggaggaggaggaggaggaggaggaggaggag
gggggggaaggggggctgcttctcgaatctgcacttacaaatcgccttaagcctaccacc
gcttgccgcaaggcagtaaaggactacgttcggcacaaaataatgcctgacaagacactc
acagtggcggcctacgcagctggtgcctctctcgccgccattacgctaatctacgttttt
ggtcccacctattttctcgataatgatccatcggctaactcaaccagcgtgttctcgatc
aagaggaatggtgccgtgggcctaatcaatccggcaaacgattgcttcatcaactcagtt
ctgcaggctctcgctggccttggggacctccgtttatacctcatccgggagactcatcgt
cgatgcctggacggtggctgggtgtatgcgcagaccatcccgagcgatgtttggggcagt
ggtggcgaaggcgaaggcgacgagacaagcaaatggcaagtccgtggtggtgttcccgag
tggaaagccgaaggacttcagatgggtatcgtcaccaagggcttaaaggatatccttgac
gccctgaacgagagaccaatctacaaaaagacgatctcggcctcgccgtttgtcaggaca
ctggagattgcctttggtcagcggatcagcagacagcaacaggacgcccaggagttcctt
caggtcgtggccgagaggctctgcgacgagtatcatgctggccagagagcgcgaagctac
gctatgcgtggagccgagcaaccaactactaagatatctctcaatagcaagacatcagac
agtgaagctctggatcggcctctacctctaagggccagtgagcaggtcagtggcgctgac
caaccggcggcaacggccgcgagcgcggttccgaacggcgccgatgaagaaagagcagaa
gaagggttcccgtttgaaggaagctttgaatctcagattgaatgccttacttgtggtttc
agacccaggcccactcagtcaaccttctgcaccctaacactgaacgtgccacatatccca
acaacaactctgagcgcatgcttcgacggcatgttcaaaaccgagtacatcgaggatttc
aaatgtgaaaagtgccggttgttacatgccaaggccgttctcgaagcagatattcagcgg
tcaacgtcagagtcctcgagggagaaagctcgcacggctctagccagtctcgagctagct
atcgaaacggatcctgagaaggcaccaaagggtgtcgagttgccggatcctcgctatgct
cccaagcggaagatagctcgacacatccgtatgacaggatttcccaggatcttggccatc
catctgtcgcggtcgatatacgacatgagcaacttctcccagaaaaatcttgcgaaggtt
acatttccggaactattgcccctgggtggccttctgcagcagagaaaatacaagcttctt
ggcgttgtgacgcacaagggtaatcaccatagcgggcactatgaatcctttagacgacaa
aacatatacccacccttctctaaccccggtacctttcaaccttccggggcgtacatatac
accagttcgccttcaaatatcaatcctggacaagccattcaaccaggatccggacaggct
ccaacaccaggagtagaaggcggtattacacctgcgaacgagcctagatcgacatctacg
tctcgggaaagagataccgacacgaacagccttcgatctgcggccgcatctgcgcgctca
accttgatcaagattgcctcaaaaccatcctctcgcgctggcagcccggacataaccggg
tcgaaacctcacaccaagacacctgtgaaatccaaacggcacaaatcaagcagccgatgg
tggcgtatcagtgacgacaaagtcaaagaagcaagtactcgcgacgtactgggcatgcaa
cgagaggtttacttgctgttctatgaactcgaacgagagaattcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system