KEGG   Neurospora crassa: NCU08579Help
Entry
NCU08579          CDS       T01034                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
ncr  Neurospora crassa
Brite
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCU08579
Peptidases [BR:ncr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCU08579
Ubiquitin system [BR:ncr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    NCU08579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 621 aa AA seqDB search
MPDKTLTVAAYAAGASLAAITLIYVFGPTYFLDNDPSANSTSVFSIKRNGAVGLINPAND
CFINSVLQALAGLGDLRLYLIRETHRRCLDGGWVYAQTIPSDVWGSGGEGEGDETSKWQV
RGGVPEWKAEGLQMGIVTKGLKDILDALNERPIYKKTISASPFVRTLEIAFGQRISRQQQ
DAQEFLQVVAERLCDEYHAGQRARSYAMRGAEQPTTKISLNSKTSDSEALDRPLPLRASE
QVSGADQPAATAASAVPNGADEERAEEGFPFEGSFESQIECLTCGFRPRPTQSTFCTLTL
NVPHIPTTTLSACFDGMFKTEYIEDFKCEKCRLLHAKAVLEADIQRSTSESSREKARTAL
ASLELAIETDPEKAPKGVELPDPRYAPKRKIARHIRMTGFPRILAIHLSRSIYDMSNFSQ
KNLAKVTFPELLPLGGLLQQRKYKLLGVVTHKGNHHSGHYESFRRQNIYPPFSNPGTFQP
SGAYIYTSSPSNINPGQAIQPGSGQAPTPGVEGGITPANEPRSTSTSRERDTDTNSLRSA
AASARSTLIKIASKPSSRAGSPDITGSKPHTKTPVKSKRHKSSSRWWRISDDKVKEASTR
DVLGMQREVYLLFYELERENS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaagacactcacagtggcggcctacgcagctggtgcctctctcgccgccatt
acgctaatctacgtttttggtcccacctattttctcgataatgatccatcggctaactca
accagcgtgttctcgatcaagaggaatggtgccgtgggcctaatcaatccggcaaacgat
tgcttcatcaactcagttctgcaggctctcgctggccttggggacctccgtttatacctc
atccgggagactcatcgtcgatgcctggacggtggctgggtgtatgcgcagaccatcccg
agcgatgtttggggcagtggtggcgaaggcgaaggcgacgagacaagcaaatggcaagtc
cgtggtggtgttcccgagtggaaagccgaaggacttcagatgggtatcgtcaccaagggc
ttaaaggatatccttgacgccctgaacgagagaccaatctacaaaaagacgatctcggcc
tcgccgtttgtcaggacactggagattgcctttggtcagcggatcagcagacagcaacag
gacgcccaggagttccttcaggtcgtggccgagaggctctgcgacgagtatcatgctggc
cagagagcgcgaagctacgctatgcgtggagccgagcaaccaactactaagatatctctc
aatagcaagacatcagacagtgaagctctggatcggcctctacctctaagggccagtgag
caggtcagtggcgctgaccaaccggcggcaacggccgcgagcgcggttccgaacggcgcc
gatgaagaaagagcagaagaagggttcccgtttgaaggaagctttgaatctcagattgaa
tgccttacttgtggtttcagacccaggcccactcagtcaaccttctgcaccctaacactg
aacgtgccacatatcccaacaacaactctgagcgcatgcttcgacggcatgttcaaaacc
gagtacatcgaggatttcaaatgtgaaaagtgccggttgttacatgccaaggccgttctc
gaagcagatattcagcggtcaacgtcagagtcctcgagggagaaagctcgcacggctcta
gccagtctcgagctagctatcgaaacggatcctgagaaggcaccaaagggtgtcgagttg
ccggatcctcgctatgctcccaagcggaagatagctcgacacatccgtatgacaggattt
cccaggatcttggccatccatctgtcgcggtcgatatacgacatgagcaacttctcccag
aaaaatcttgcgaaggttacatttccggaactattgcccctgggtggccttctgcagcag
agaaaatacaagcttcttggcgttgtgacgcacaagggtaatcaccatagcgggcactat
gaatcctttagacgacaaaacatatacccacccttctctaaccccggtacctttcaacct
tccggggcgtacatatacaccagttcgccttcaaatatcaatcctggacaagccattcaa
ccaggatccggacaggctccaacaccaggagtagaaggcggtattacacctgcgaacgag
cctagatcgacatctacgtctcgggaaagagataccgacacgaacagccttcgatctgcg
gccgcatctgcgcgctcaaccttgatcaagattgcctcaaaaccatcctctcgcgctggc
agcccggacataaccgggtcgaaacctcacaccaagacacctgtgaaatccaaacggcac
aaatcaagcagccgatggtggcgtatcagtgacgacaaagtcaaagaagcaagtactcgc
gacgtactgggcatgcaacgagaggtttacttgctgttctatgaactcgaacgagagaat
tcataa

DBGET integrated database retrieval system