KEGG   Neurospora crassa: NCU08898Help
Entry
NCU08898          CDS       T01034                                 

Definition
homoaconitase, mitochondrial precursor
Orthology
K01705  
homoaconitate hydratase [EC:4.2.1.36]
Organism
ncr  Neurospora crassa
Pathway
Lysine biosynthesis
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NCU08898
   01230 Biosynthesis of amino acids
    NCU08898
  Amino acid metabolism
   00300 Lysine biosynthesis
    NCU08898
Enzymes [BR:ncr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.36  homoaconitate hydratase
     NCU08898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V
AA seq 784 aa AA seqDB search
MIHPVRRALAVAASRAPRQFLAAASRTTSVRSVRAAAASGSYYSTTSRRLQDAFPSQLEN
LASSTLPKVVPQVPQTLTEKIVQRYSVGLAPGKKVKSGDYVTLQPHHCMTHDNSWPVAMK
FMSIGASKIHDNRQVVMTLDHDVQNKSEANLKKYRQIEEFANTHGVDFYPAGRGIGHQIM
VEEGYAWPGTVTVASDSHSNMYGGVGCLGTPMVRTDAASIWATGKTWWQIPPIAKVTFTG
LLPPGVTGKDVIVALCGLFNNDDVLNHAIEFTGAEETMRSIPVDDRLTIANMTTEWGALS
GLFPIDAVLASWMRAKATVTAMEHPELGDKAKFTHAKIDALLENPLVADPGATYAKQLYL
NLSTLSPFVAGPNSVKIATPLKDLEAQNLKLDKAYLVSCTNSRASDIAAAARVFKDAAAD
NNGVIPKVAPGVKFYIAAASLLEQKQAEDSGDWQVLLDAGAEPLPSGCGPCIGLGTGLLE
PGEIGISASNRNFKGRMGSTDAKAYLASPEVVAASALKGKIAGPGWYQKPEGVEKVIIGE
GNGVVEQDKAMSIEDALDKIIAEAESLIANAEAGLTPESTSSSSSSSSSSEEESLTEILP
GFPEAISGEIIFCDADNINTDGIYPGKYTYQDNITPAKMAEVCMENYDASFGSIARAGDI
LVTGFNFGCGSSREQAATAILAKQIPLVVSGSFGNIFSRNSINNALMGVEVPKLVQRLRE
EFGDKVATRRTGWKLTWDVRRSKVVVEEASGKKWEQKVGELPPNVQEIIARGGLEKWVKS
QIEA
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgattcaccccgtgagaagagccctggccgtggctgccagcagagccccccgtcaattc
cttgcagccgcctcgagaaccacctctgtccgcagtgtccgcgccgccgccgcctccggt
tcctactacagcaccacctcgcgccgtcttcaagatgccttcccctcgcagctcgagaat
ctggcctcctcgaccctccccaaggtcgtcccccaggtgccccagaccttgaccgagaag
attgtccagcgctactcggtcggcctcgctcccggcaagaaggtcaagtctggcgactat
gtcaccctccagcctcaccactgcatgacccacgacaactcgtggcccgtcgccatgaag
ttcatgtccatcggcgcctccaagatccacgacaaccgccaggtcgtcatgaccctcgac
cacgacgtgcagaacaagagcgaggccaacctcaaaaagtaccgccagatcgaggagttc
gccaacacgcacggcgtcgatttctaccctgccggccggggcatcggccaccagatcatg
gttgaagagggctacgcgtggccgggcaccgtcactgtcgcctccgactcgcacagcaac
atgtacggcggtgttggctgcctgggcacgcccatggtgcgtaccgacgcggcctccatc
tgggctaccggcaagacatggtggcagatcccgcccatcgccaaggtcaccttcaccggt
ctgctcccgcccggtgtcacgggtaaggacgtgatcgttgctttgtgcggcctattcaac
aacgacgacgtgctcaaccacgccatcgagttcaccggtgccgaagaaaccatgcgctcc
atccccgtcgacgaccgcctgaccatcgccaacatgaccaccgaatggggcgccctctcc
ggtctcttccccatcgacgccgtcctggcctcctggatgcgcgccaaggccaccgtcacc
gccatggaacaccccgagctgggcgacaaggccaagttcacccacgccaagatcgacgcc
cttctcgagaaccctctggttgccgaccccggcgccacttacgccaaacagctctacctc
aacctgtccaccctctcccccttcgtcgccggccccaactccgtcaagatcgctactccc
ctcaaggacctcgaggcccaaaacctcaagctcgacaaggcgtacctcgtctcgtgcacc
aactcgcgcgcctccgacatcgccgccgccgcccgcgtgttcaaggacgccgctgctgac
aacaacggtgtcatccccaaggtcgctcccggcgtcaagttctacatcgccgccgcctcc
ctcctcgagcaaaagcaagccgaagactcgggcgactggcaagtccttctcgatgctggc
gccgagcctttgccctccggctgcggcccctgcatcggtctgggcaccggtctgttggag
cccggtgagatcggcatctctgcttccaaccgtaacttcaagggccgcatgggttccacc
gacgccaaggcctacctcgcctcgcccgaagtcgtcgctgcttctgctctgaagggcaag
atcgccggtcccggttggtaccaaaagcccgagggtgtcgagaaggtaatcatcggcgaa
ggcaacggtgtcgttgagcaagacaaggccatgtccattgaagacgctctcgacaagatc
attgccgaggccgagtcgctcatcgccaacgccgaggctggcctcactcccgagtccacc
tcttcttcttcttcttcttcttcgtcgtcggaagaagaatccctcactgaaatcctcccc
ggcttccccgaagccatttccggcgaaatcatcttctgcgacgccgacaacatcaacacg
gacggcatctaccccggcaaatacacctaccaggacaacatcaccccggccaagatggcc
gaagtctgcatggagaactacgatgcctcctttggctccatcgcgcgcgccggcgacatt
ctcgtgacaggcttcaactttggctgcggttcctcgcgtgagcaagcggcgaccgccatc
ctagcaaagcaaatcccgctggtggtcagcggcagtttcggcaacatctttagcaggaac
tccatcaacaacgcgctgatgggcgtcgaggtgcccaagctggttcagcgactccgtgaa
gaattcggcgacaaggtggctactagacgcaccgggtggaagttgacgtgggatgtgcga
cgcagcaaggtggttgtcgaagaggcgtcaggcaagaagtgggagcaaaaggtgggcgag
ttgccgccgaatgtgcaggagattattgccaggggaggattggagaagtgggtcaagagt
cagattgaggcttga

DBGET integrated database retrieval system