KEGG   Neurospora crassa: NCU08997Help
Entry
NCU08997          CDS       T01034                                 

Definition
repressible alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCU08997
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCU08997
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCU08997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III
AA seq 587 aa AA seqDB search
MAPSPERTPLLASDQSPDRENDNAAPRSRWRELALFTWALLATAAVIVLAVVIQHSNSTQ
HSSISPAAVSDSSSVAGDKKHGSPSGGKRNLVFMVSDGMGPASLSLTRSFRQLTQDLPID
DTLTLDRHFWGTSRTRSSNSLVTDSAAGATAFSCGLKSYNGAISMLPDHTPCGTVLEAAK
RAGYHTGLVVTTDITDATPACFAAHVFHRMQGDEIALHEIGHGPLGRVVDLMLGGGRCHF
LPKGTPGSCRQDDIDVTKLAQEEYGWNYVSDRAGFDSLGLGKNVSLPQLGLFATTDVPFE
IDRCNMADVYPSLSEMAATALAALEEATKDSDKGFFLMIEGSRIDHAGHINDPAAQVREV
LEYDKTFKSVLDFIEKSDTETILVATSDHETGGLSTAWQAPSELPVYNWHPTVLARANAS
SELLTALLLKHIAETGDKEEPLLRWINDELVVKHLNIKDASEVELNSIASNPALAIQLFA
RMVSVRARVGWSTHGHSAVDVNIYSSGGPGTEKIRGNVENTDVGKFLRGWLDLDSEVENI
TKELVKKLGDKAPSQKQLNKIEKASTAFEDDGVAHGGFESGLYGHVL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctccggaacgcacgccattgttggcctctgaccagtctcccgatcgcgag
aacgacaatgccgctcccaggtcacgatggcgcgagcttgcgctcttcacctgggccctt
ctggctaccgccgccgtcatcgttttggccgtggtgatccagcacagtaactccacccaa
cactcgtcgatctcgccggccgcagtctctgactcctcctctgtagccggcgacaagaag
cacggttccccgtccggcggcaagcgcaacttggtcttcatggtgtccgatggcatggga
cccgcttcgctctctcttacgcgctccttccgccagctcacccaggacttgcctatcgac
gataccctcaccctcgaccgtcacttttggggtacctcccgcacgcgctcgagcaacagc
ttggtgacggactctgctgccggtgccactgccttctcctgcggcctgaagagctacaat
ggcgctatctcgatgcttcccgatcacacaccctgtggtaccgtcctcgaggctgccaag
cgtgctgggtaccacaccggcttggtggtgacgaccgatatcacggacgccactcctgct
tgcttcgccgctcacgtctttcatcgcatgcaaggcgatgagattgcgctacatgagatc
ggtcatggacccctcggtcgcgttgtcgatctcatgctgggcggcggcaggtgccacttc
ttgcccaagggaactccgggcagctgcagacaggatgacatcgatgttactaagctcgcc
caggaggagtatggatggaactacgttagtgatcgcgccggcttcgattccctgggcttg
ggcaagaacgtttccttgccccagttgggtctatttgcgaccacagatgttcccttcgag
atcgaccgctgcaacatggcggatgtgtaccctagtctgagcgagatggctgccacggct
ctggcggcgcttgaggaggctaccaaggacagcgacaagggtttcttcctcatgattgag
ggtagcagaatcgaccatgccggtcacattaacgatcctgctgctcaggttcgtgaggtg
cttgagtacgacaagactttcaagtctgtccttgacttcattgagaagtcggacactgag
accattttggttgccaccagcgatcacgaaactggtggtctgtccactgcttggcaggcg
cccagcgaacttcccgtctacaactggcaccccactgtcctcgctcgcgccaacgcctca
tctgagctcctcaccgccctcctcctcaagcacattgccgaaaccggcgacaaggaagag
ccgctcctccgctggatcaatgacgagctcgttgtcaagcacctcaacatcaaggacgcc
tccgaggttgagcttaactcgattgccagcaaccccgccctggccatccagctttttgcc
cgcatggtcagcgtccgcgcccgtgtgggctggagcacgcacggccacagcgccgtggac
gtaaacatctacagctctggcggccccggcaccgagaaaatcaggggtaacgtggagaac
acggatgtcggcaagttcctgaggggatggctcgatttggatagcgaggtggagaatatc
accaaagagctggtcaagaagctgggcgacaaggctccctcgcagaagcagttgaacaag
attgagaaggcgtcgaccgcttttgaggatgatggagtggctcatggcgggtttgagtcg
ggactttatggccatgtgttgtaa

DBGET integrated database retrieval system